BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1249 (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62370.1 68418.m07828 pentatricopeptide (PPR) repeat-containi... 30 1.4 At5g06850.1 68418.m00774 C2 domain-containing protein contains I... 30 1.4 At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 30 1.4 At2g37730.1 68415.m04627 fringe-related protein similarity to pr... 30 1.4 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 29 1.8 At2g47210.1 68415.m05896 myb family transcription factor contain... 29 2.4 At1g74850.1 68414.m08674 pentatricopeptide (PPR) repeat-containi... 29 3.2 At1g14960.1 68414.m01787 major latex protein-related / MLP-relat... 29 3.2 At1g01570.1 68414.m00074 fringe-related protein + similar to hyp... 29 3.2 At4g23490.1 68417.m03384 fringe-related protein + weak similari... 28 4.2 At3g09520.1 68416.m01131 exocyst subunit EXO70 family protein co... 28 4.2 At5g20840.1 68418.m02475 phosphoinositide phosphatase family pro... 28 5.6 At5g16715.1 68418.m01957 tRNA synthetase class I (I, L, M and V)... 28 5.6 At3g20330.1 68416.m02576 aspartate carabmoyltransferase, chlorop... 28 5.6 At2g27090.1 68415.m03255 expressed protein contains Pfam domains... 28 5.6 At5g04060.1 68418.m00387 dehydration-responsive protein-related ... 27 7.4 At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein ... 27 7.4 At4g11420.1 68417.m01840 eukaryotic translation initiation facto... 27 7.4 At1g22850.1 68414.m02853 expressed protein 27 7.4 At5g42570.1 68418.m05183 expressed protein low similarity to SP|... 27 9.7 At5g35604.1 68418.m04242 hypothetical protein 27 9.7 At4g36210.2 68417.m05152 expressed protein contains Pfam PF05277... 27 9.7 At4g36210.1 68417.m05151 expressed protein contains Pfam PF05277... 27 9.7 At4g15310.1 68417.m02343 cytochrome P450-related contains weak s... 27 9.7 At4g11350.1 68417.m01831 fringe-related protein various hypothet... 27 9.7 At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 27 9.7 At2g41790.1 68415.m05165 peptidase M16 family protein / insulina... 27 9.7 At1g36763.1 68414.m04575 hypothetical protein 27 9.7 At1g22600.1 68414.m02822 hypothetical protein 27 9.7 >At5g62370.1 68418.m07828 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 982 Score = 29.9 bits (64), Expect = 1.4 Identities = 28/78 (35%), Positives = 38/78 (48%) Frame = -1 Query: 359 LSHQVSPVTDLVAGFCLSPVSVLERRLVLAMKTWPFSCLDSAGELVKRVGEGSYALYSII 180 LS ++ P T A F + R L L +K LDSA E+++RV +GS SI Sbjct: 22 LSSELFPSTS-AAVFSAASGDHRSRCLSLIVKLGRRGLLDSAREVIRRVIDGS---SSIS 77 Query: 179 QAPAPRVAAVDQGVPLVS 126 +A AVD G+ L S Sbjct: 78 EAALVADFAVDNGIELDS 95 >At5g06850.1 68418.m00774 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 669 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 377 EHRLLYLSHQVSPVTDLVAGFCLSPVSVLERRL 279 E L + ++V+P D V G +SP+SV E+RL Sbjct: 154 EQFFLTVENKVTPAKDEVMGRLISPLSVFEKRL 186 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 150 DRSDAWGRCLDD-AVQRVRAFTNSLDELASRVQAAERPGLHGEDQ 281 D ++A R DD VQRV LD+L +R+Q A++ G+ + Sbjct: 86 DHNEATSRHHDDWKVQRVNTMMTILDDLKTRIQKAQQQSSSGKKE 130 >At2g37730.1 68415.m04627 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 532 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -1 Query: 236 AGELVKRVGEGSYALYSIIQAPAPRVAAV--DQGVPLVSELGHLAADRAGQLAGLFLSRP 63 A ELVK + +G Y+ + ++ A + GVPL ELG D G GL + P Sbjct: 252 AVELVKLL-DGCIDRYASLYGSDQKIEACLSEIGVPLTKELGFHQVDIRGNPYGLLAAHP 310 Query: 62 VA 57 VA Sbjct: 311 VA 312 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 143 GVPLVSELGHLAADRAGQLAGLFLSRPVA 57 GVPL ELG D G L GL + PVA Sbjct: 299 GVPLTKELGFHQYDVYGNLFGLLAAHPVA 327 >At2g47210.1 68415.m05896 myb family transcription factor contains Pfam profile: PF00249 myb DNA-binding domain Length = 441 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 461 ARNPWQRRPHRRGPRMPADGPAPPHRR 381 A P ++ R+GP AD P+P H+R Sbjct: 406 AERPIKKEQKRKGPGRQADTPSPAHKR 432 >At1g74850.1 68414.m08674 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 862 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = +1 Query: 223 TSSPAESKQL----NGQVFMARTRRRSSTDTGERQNPATR 330 TS +E+K L N +F A TR +S+DT NP R Sbjct: 810 TSEESENKNLVALANSPIFAAGTRASTSSDTNHSGNPTQR 849 >At1g14960.1 68414.m01787 major latex protein-related / MLP-related low similarity to major latex protein {Papaver somniferum}[GI:20810] contains Pfam profile PF00407: Pathogenesis-related protein Bet v I family Length = 153 Score = 28.7 bits (61), Expect = 3.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 520 LTMSWRQRTGDHPKMIELMNF 582 +TM W +RT D P+ IE M F Sbjct: 116 ITMVWEKRTEDSPEPIEFMKF 136 >At1g01570.1 68414.m00074 fringe-related protein + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 478 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -1 Query: 191 YSIIQAPAPRVAAV--DQGVPLVSELGHLAADRAGQLAGLFLSRPVA 57 YS + R+ A + GVPL E+G D G+L GL + P+A Sbjct: 229 YSELYGSDDRIHACMSELGVPLTKEVGFHQIDLYGKLLGLLSAHPLA 275 >At4g23490.1 68417.m03384 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 526 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -1 Query: 143 GVPLVSELGHLAADRAGQLAGLFLSRPVAAGVA 45 GVPL ELG D G L GL + PV V+ Sbjct: 300 GVPLTKELGFHQYDVYGNLFGLLAAHPVTPFVS 332 >At3g09520.1 68416.m01131 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 628 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 210 TNSLDELASRVQAAERPGLHGEDQATLKHRHWRETKSSYQISYWRNLMT*IQES 371 TN+L + SR +++ L GED T R+ SY+ W ++ + E+ Sbjct: 457 TNNLQHVVSRARSSNLKNLLGEDWITRHFAKMRQFAGSYKRLAWGPVVATLPEN 510 >At5g20840.1 68418.m02475 phosphoinositide phosphatase family protein contains similarity to phosphoinositide phosphatase SAC1 [Rattus norvegicus] gi|11095248|gb|AAG29810; contains Pfam domain, PF02383: SacI homology domain; identical to cDNA SAC domain protein 4 (SAC4) GI:31415724 Length = 831 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 6 SDTSDTEPSRDSEGDSRGYRSAEEQAR 86 S +DT P S+ DSR Y S E+ R Sbjct: 438 SSDADTSPHNSSDDDSRDYDSLEKNCR 464 >At5g16715.1 68418.m01957 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P11931 Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase) (VALRS) {Bacillus stearothermophilus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 970 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 181 MMLYSAYE-PSPTLLTSSPAESKQLNGQVFMARTRRR 288 M+L +A+ P+PT SP+ QLN +F R RRR Sbjct: 1 MILKTAFSLPTPTTTLLSPSSPHQLN-TLFFTRRRRR 36 >At3g20330.1 68416.m02576 aspartate carabmoyltransferase, chloroplast / aspartate transcarbamylase / ATCase (PYRB) identical to SP|P49077 Aspartate carbamoyltransferase, chloroplast precursor (EC 2.1.3.2) (Aspartate transcarbamylase) (ATCase) {Arabidopsis thaliana} Length = 390 Score = 27.9 bits (59), Expect = 5.6 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = +1 Query: 178 WMMLYSAYEPSPTLLTSSPAESKQLNGQVFMARTRRR-SSTDTGERQNPATRSVTG 342 ++M YEPS S + K+L G+V R SS GE R+V G Sbjct: 124 YLMATLFYEPSTRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTVEG 179 >At2g27090.1 68415.m03255 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 743 Score = 27.9 bits (59), Expect = 5.6 Identities = 20/81 (24%), Positives = 32/81 (39%) Frame = +3 Query: 21 TEPSRDSEGDSRGYRSAEEQARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRV 200 TE SR S + + EL ++ + +A + +DR AW R L D V+ Sbjct: 388 TESSRSSSSRNPLGGMNSDDVEELNSNLFENICMIAGSHASTLDRLYAWERKLYDEVKGS 447 Query: 201 RAFTNSLDELASRVQAAERPG 263 + DE ++ E G Sbjct: 448 QTVRREYDEKCRILRELESEG 468 >At5g04060.1 68418.m00387 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 600 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 174 CLDDAVQRVRAFTNSLDELASRVQAAERPGLHGEDQATLKHRHWRETKSSY 326 C+D + R + ++ D L+S + G+ ED+ TL WRE + Y Sbjct: 391 CVDISENRQQKPSSLTDRLSSYPTSLREKGI-SEDEFTLDTNFWREQVNQY 440 >At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 718 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 271 P*RPGRSAAWTLLASSSRELVKARTRCTASSKHL 170 P RP + +AW L +S E +A R ASS L Sbjct: 397 PKRPVKISAWKLAKLNSNEATRAAARARASSSVL 430 >At4g11420.1 68417.m01840 eukaryotic translation initiation factor 3 subunit 10 / eIF-3 theta / eIF3a (TIF3A1) identical to eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (Eukaryotic translation initiation factor 3 large subunit) (eIF3a) (p114). [Arabidopsis thaliana] SWISS-PROT:Q9LD55 Length = 987 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 6/48 (12%) Frame = +3 Query: 384 PVGRSGPVSWHAWPATVGPALPGVPRWFR------GPTVGTSRHASQR 509 PVG + P + A A PA P VP+W R GP+ TS +R Sbjct: 876 PVGTTAPAA--AAAAAGAPAAPYVPKWKRQTTEVSGPSAPTSSETDRR 921 >At1g22850.1 68414.m02853 expressed protein Length = 344 Score = 27.5 bits (58), Expect = 7.4 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = -1 Query: 224 VKRVGEGSYALYSIIQAPAPRVAAVDQGVPLVSELGHLAADRAGQLAGLFLSRPVAAGVA 45 ++ G YAL+ + A +A +PL G L G + + +S +AA VA Sbjct: 145 IEGYGTAGYALFIAVYAGLEILAI--PALPLTMSAGLLFGPLIGTII-VSISGTMAASVA 201 Query: 44 FAVSRWFS 21 F ++R+F+ Sbjct: 202 FLIARYFA 209 >At5g42570.1 68418.m05183 expressed protein low similarity to SP|P51572 B-cell receptor-associated protein 31 (6C6-AG tumor-associated antigen) (DXS1357E) {Homo sapiens} Length = 218 Score = 27.1 bits (57), Expect = 9.7 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 51 SRGYRSAEEQARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRVRAFTNSLD 224 +RG+ + + E +++ E+A L K TL S++ G+ L A A D Sbjct: 128 NRGFEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQAD 185 >At5g35604.1 68418.m04242 hypothetical protein Length = 298 Score = 27.1 bits (57), Expect = 9.7 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 7/53 (13%) Frame = -1 Query: 476 GSTEPARNPWQRRP-----HR--RGPRMPADGPAPPHRRREHRLLYLSHQVSP 339 GS E AR+ + RP HR R PR P+ G + P R + S ++SP Sbjct: 46 GSAEGARSAYAFRPTLHREHRGGRSPRRPSRGNSSPRRDKARARTDCSPRLSP 98 >At4g36210.2 68417.m05152 expressed protein contains Pfam PF05277: Protein of unknown function (DUF726) Length = 516 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 132 KWNTLVDRSDAWGRCLDDAVQR 197 KW+ +DRSD GR L + +Q+ Sbjct: 390 KWSIAIDRSDKAGRLLAEVLQK 411 >At4g36210.1 68417.m05151 expressed protein contains Pfam PF05277: Protein of unknown function (DUF726) Length = 672 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 132 KWNTLVDRSDAWGRCLDDAVQR 197 KW+ +DRSD GR L + +Q+ Sbjct: 512 KWSIAIDRSDKAGRLLAEVLQK 533 >At4g15310.1 68417.m02343 cytochrome P450-related contains weak similarity to Pfam profile: PF00067: Cytochrome P450 Length = 324 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 267 EDLAVQLLGLCWRARQESW 211 E AV+ LGLCW A + SW Sbjct: 97 ESEAVKELGLCWSAFRTSW 115 >At4g11350.1 68417.m01831 fringe-related protein various hypothetical proteins from Arabidopsis thaliana strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 489 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 143 GVPLVSELGHLAADRAGQLAGLFLSRPVAAGVA 45 GVPL E+G D G L GL + P+ V+ Sbjct: 263 GVPLTKEIGFHQYDVHGNLFGLLAAHPITPFVS 295 >At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family protein Length = 477 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 437 PHRRGPRMPADGPAPP 390 PHR P PA PAPP Sbjct: 403 PHRSQPHPPAPNPAPP 418 >At2g41790.1 68415.m05165 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain; similar to insulin-degrading enzyme (Insulysin, Insulinase, Insulin protease) [Mouse] SWISS-PROT:Q9JHR7 Length = 970 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 145 WSTAATRGAGAWMMLYSAYEPSPTLLTSSPAESKQLNGQVF 267 W+T + G G W + YS ++ S L + +++ G +F Sbjct: 316 WATGLSAGEGEWTLDYSFFKVSIDLTDAGHEHMQEILGLLF 356 >At1g36763.1 68414.m04575 hypothetical protein Length = 104 Score = 27.1 bits (57), Expect = 9.7 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -1 Query: 428 RGPRMPADGPAPPHRRREHRLLY-LSHQVSPVTDLVA--GFCLSPVSVLE 288 R ++ D P RR H+ L HQV P+ DL+ G +SP + L+ Sbjct: 11 RSFKISRDHSTPRSSRRHHQFTSPLDHQVEPLLDLITPPGSRVSPSTPLD 60 >At1g22600.1 68414.m02822 hypothetical protein Length = 385 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 9 DTSDTEPSRDSEGDSRGYRSAEEQARELARSIRREVAKLADKWNTL 146 DTSD S +S G +RG + E+ E +++ + KL+++ L Sbjct: 312 DTSDQSQSSESAGRTRGKKKVTEKTDE--DVVKQRLTKLSERMRKL 355 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,804,985 Number of Sequences: 28952 Number of extensions: 296905 Number of successful extensions: 1159 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -