BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1246 (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 5.2 AF283265-1|AAG15372.1| 67|Anopheles gambiae beta-hexosaminidas... 23 6.9 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 5.2 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 399 HEDEENWPLEDKPCKINHKKQSTIPLNSQQSFTKDDWLAITI 524 H +++ L + K+ QS I L + TK+DW+ I + Sbjct: 387 HRSHDSFVLFPRKVKVG---QSKILLILHEPLTKEDWIKIKV 425 >AF283265-1|AAG15372.1| 67|Anopheles gambiae beta-hexosaminidase, beta chain protein. Length = 67 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 393 VEHEDEENWPLEDKPCKINHKKQSTIPLN 479 V + DE LE++ C++NH+ P N Sbjct: 33 VNNADEAARRLEEQTCRMNHRGIPAQPPN 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 513,422 Number of Sequences: 2352 Number of extensions: 9620 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -