BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1246 (563 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79755-10|CAB02109.1| 2034|Caenorhabditis elegans Hypothetical p... 33 0.14 U57652-1|AAB02243.1| 2034|Caenorhabditis elegans FER-1 protein. 33 0.14 Z77663-18|CAC70092.2| 191|Caenorhabditis elegans Hypothetical p... 28 4.0 Z77654-6|CAB01128.3| 191|Caenorhabditis elegans Hypothetical pr... 28 4.0 U39648-3|AAM15603.1| 434|Caenorhabditis elegans Hypothetical pr... 28 5.3 AL110501-3|CAB54506.1| 199|Caenorhabditis elegans Hypothetical ... 27 9.3 >Z79755-10|CAB02109.1| 2034|Caenorhabditis elegans Hypothetical protein F43G9.6 protein. Length = 2034 Score = 33.1 bits (72), Expect = 0.14 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 375 LAVLRIVEHEDEENWPLEDKPCKINHKKQSTIPLNSQQSFTK 500 LA + ED++ PLE K CK N+K++S IP + F K Sbjct: 1096 LACFELYSEEDKDLIPLEPK-CKHNYKERSEIPTEFRPQFDK 1136 >U57652-1|AAB02243.1| 2034|Caenorhabditis elegans FER-1 protein. Length = 2034 Score = 33.1 bits (72), Expect = 0.14 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 375 LAVLRIVEHEDEENWPLEDKPCKINHKKQSTIPLNSQQSFTK 500 LA + ED++ PLE K CK N+K++S IP + F K Sbjct: 1096 LACFELYSEEDKDLIPLEPK-CKHNYKERSEIPTEFRPQFDK 1136 >Z77663-18|CAC70092.2| 191|Caenorhabditis elegans Hypothetical protein C50B8.5 protein. Length = 191 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 247 SLIELFPNDKIMMLDLFL*TSILLGSVGYV 336 S + LFP++ + +L L L ILLG VGY+ Sbjct: 62 SKLTLFPSEWLYLLVLMLIVLILLGLVGYL 91 >Z77654-6|CAB01128.3| 191|Caenorhabditis elegans Hypothetical protein C50B8.5 protein. Length = 191 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 247 SLIELFPNDKIMMLDLFL*TSILLGSVGYV 336 S + LFP++ + +L L L ILLG VGY+ Sbjct: 62 SKLTLFPSEWLYLLVLMLIVLILLGLVGYL 91 >U39648-3|AAM15603.1| 434|Caenorhabditis elegans Hypothetical protein T13C5.2 protein. Length = 434 Score = 27.9 bits (59), Expect = 5.3 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = -1 Query: 560 HVDGCCHFHHVHNCNSKPVIF 498 H + CC++H+ H+CN+ P ++ Sbjct: 191 HHNNCCNYHN-HSCNACPKVY 210 >AL110501-3|CAB54506.1| 199|Caenorhabditis elegans Hypothetical protein Y79H2A.4 protein. Length = 199 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 333 C*KTEMPRDILSDSLAVLRIVEHE-DEENWPLEDKPC 440 C +T+ RD LS ++ V++ + NW L++KPC Sbjct: 87 CGQTKKERDALSKAVKRAGAVQYMFNIGNWKLDEKPC 123 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,178,588 Number of Sequences: 27780 Number of extensions: 216009 Number of successful extensions: 398 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1166125180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -