BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1246 (563 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 28 3.7 At1g67390.1 68414.m07670 F-box family protein contains Pfam PF00... 27 6.5 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +3 Query: 345 EMPRDILSDSLAVLR--IVEHEDEENWPLED 431 E+P ++ S A+L I H+DE NWPL+D Sbjct: 140 EIPA-LMGVSKAILENVIFVHQDESNWPLQD 169 >At1g67390.1 68414.m07670 F-box family protein contains Pfam PF00646: F-box domain Length = 479 Score = 27.5 bits (58), Expect = 6.5 Identities = 20/76 (26%), Positives = 36/76 (47%) Frame = -1 Query: 560 HVDGCCHFHHVHNCNSKPVIFSEALLTIERDSGLLLVINLAWFVLKRPILFIFMLHNSQH 381 H+ GC H H+C + + LLT+E+++ L + N +R + F + H Sbjct: 118 HLMGCSIHHFAHHCVNGVLENWIRLLTLEKNTRFLSLCNKLG-KGRRTNVLRFSPNTFSH 176 Query: 380 SKAVTQYVSRHFSLLT 333 K T ++ R + L+T Sbjct: 177 PKLATLFL-RRYDLVT 191 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,323,558 Number of Sequences: 28952 Number of extensions: 189734 Number of successful extensions: 375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -