BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1245 (293 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 1.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 1.4 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 1.4 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 1.4 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 1.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 1.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 1.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 1.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 1.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 1.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 1.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 1.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 1.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 1.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 1.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 1.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 1.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 1.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 1.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 1.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 1.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 1.8 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 1.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 1.8 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 1.8 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 1.8 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 1.8 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 1.8 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 1.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 1.8 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 1.8 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 1.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 1.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 1.8 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 1.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 1.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 1.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 1.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 1.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 1.8 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 3.1 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 3.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 3.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 3.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 3.1 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 3.1 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 3.1 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 3.1 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 3.1 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 3.1 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 3.1 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 3.1 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 3.1 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 3.1 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 3.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 3.1 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 3.1 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 3.1 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 3.1 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 3.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 3.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 3.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 3.1 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 3.1 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 21 4.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 4.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 4.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 4.2 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 21 4.2 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 20 5.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 20 5.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 20 7.3 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 19 9.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 19 9.6 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 19 9.6 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 19 9.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 19 9.6 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 19 9.6 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 19 9.6 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 19 9.6 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 19 9.6 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.6 bits (46), Expect = 1.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 154 PVNCNTTHYRANWVPGPPSRWVAALPFNIREAVSFFIHLG 35 PV Y N++P P W+ +I+E + F H+G Sbjct: 114 PVPIPVPVYYGNFLPRPMGPWI-----SIQEQIPRFRHIG 148 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYREKDRRYEKLHN 24 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 114 YYNIINIEQIPVPVPIYCGNFPPRPMG 140 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRQYEKLHN 24 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 230 RNREYRKKDRQYEKLHN 246 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 230 RNREYRKKDRQYEKLHN 246 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 230 RNREYRKKDRQYEKLHN 246 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRQYEKLHN 257 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 1.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 230 RNREYRKKDRQYEKLHN 246 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 1.4 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 92 PPRGGARYPIRPIVSRITIHWPSFYN---VVTGKTL 190 PP Y S I +HW S +N +TG TL Sbjct: 1404 PPSAPVLYVTSSTSSSILLHWKSGHNGGASLTGYTL 1439 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 1.4 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 92 PPRGGARYPIRPIVSRITIHWPSFYN---VVTGKTL 190 PP Y S I +HW S +N +TG TL Sbjct: 1400 PPSAPVLYVTSSTSSSILLHWKSGHNGGASLTGYTL 1435 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 8 RNREYRKKDRRYEKLHN 24 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 1.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 178 SHDVVKRRPVNCNTTHYRANWVPGP 104 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 Score = 21.4 bits (43), Expect = 2.4 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +2 Query: 155 PSFYNVVTGKTLSLPNLIALQHIPLSPVG 241 P +YN++ + + +P I + P P+G Sbjct: 333 PLYYNIINIEQIPVPVPIYCGNFPPRPMG 361 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 230 RNREYRKKDRRYEKLHN 246 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 246 RNREYRKKDRRYEKLHN 262 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYKKKDRRYEKLHN 257 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 1.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ + DR Y++LH+ Sbjct: 241 RNREYRKKDRRYEKLHN 257 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYREKDRRYEKLHN 24 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYREKDRRYEKLHN 24 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYREKDRRYEKLHN 24 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 8 RNREYKEKDRRYEKLHN 24 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 230 RNREYKEKDRRYEKLHN 246 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 241 RNREYKEKDRRYEKLHN 257 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 241 RNREYKEKDRRYEKLHN 257 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 241 RNREYKEKDRRYEKLHN 257 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 3.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 RN+ DR Y++LH+ Sbjct: 241 RNREYREKDRRYEKLHN 257 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 20.6 bits (41), Expect = 4.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 209 ALQHIPLSPVGVISEWPAPIALTNSC 286 AL P PVG + AP+ L +C Sbjct: 55 ALGEAPCDPVGRRLKSLAPLVLRGAC 80 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 8 RSREYKKKDRRYDQLHN 24 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 241 RNKRMARTDRPYQQLHS 291 R++ + DR Y QLH+ Sbjct: 257 RSREYKKKDRRYDQLHN 273 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 20.6 bits (41), Expect = 4.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 209 ALQHIPLSPVGVISEWPAPIALTNSC 286 AL P PVG + AP+ L +C Sbjct: 55 ALGEAPCDPVGRRLKSLAPLVLRGAC 80 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 20.2 bits (40), Expect = 5.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 54 LTASLMLNGNAATHLEGGPGTQF 122 L ASL+ GN + H GTQF Sbjct: 7 LLASLLYLGNESVHGIQKWGTQF 29 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 20.2 bits (40), Expect = 5.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 Query: 135 VVLQFTGRRFTTS*LGKPCRYPT 203 VVL F L PC++PT Sbjct: 52 VVLSACSSYFQKLLLSNPCKHPT 74 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 19.8 bits (39), Expect = 7.3 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +1 Query: 202 LNRLAAHPPFASWRNKR 252 L+ + PP W++KR Sbjct: 192 LSFVICFPPLVGWKDKR 208 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/29 (24%), Positives = 14/29 (48%) Frame = -2 Query: 130 YRANWVPGPPSRWVAALPFNIREAVSFFI 44 Y+ +P S W +N+ +++FI Sbjct: 196 YKEYIIPANYSGWYLNHDYNLENKLNYFI 224 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 161 FYNVVTGKTLSLPNLIALQHIPLSPVG 241 +YN++ + + +P I + P P+G Sbjct: 110 YYNIINIEQIPVPVPIYCGNFPPRPMG 136 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 19.4 bits (38), Expect = 9.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 155 PSFYNVVTGKT 187 PS NV++GKT Sbjct: 88 PSTLNVISGKT 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,594 Number of Sequences: 438 Number of extensions: 2254 Number of successful extensions: 108 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 5994288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -