BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1241 (305 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.02 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 27 0.47 SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ... 25 1.9 SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual 24 5.8 SPBC13A2.04c |||PTR family peptide transporter|Schizosaccharomyc... 24 5.8 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 24 5.8 SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schiz... 24 5.8 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 23 7.7 >SPCC736.02 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 286 Score = 27.5 bits (58), Expect = 0.47 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 136 FLFAYYSTKKCFYLEINVQNIPFVSSLSKLISQNFI 243 FLF S + F L + +NIP + + K++++ I Sbjct: 165 FLFKASSLRNGFLLALKQRNIPVIRQVGKIVTERLI 200 >SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces pombe|chr 3|||Manual Length = 1364 Score = 25.4 bits (53), Expect = 1.9 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -2 Query: 181 FPNKNIFLSSNKQIEITISFNLCFTNIFN*NIFKLPKK*INSKIILTSHLLLKVYFF 11 FPN++ SSN + SF+ + +F+ N+ +L KK +N I ++ V F Sbjct: 1203 FPNESNACSSNVLEHVASSFSKWHSKVFSRNL-RLLKKYLNDVSICWEQIVYLVQDF 1258 >SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 23.8 bits (49), Expect = 5.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -3 Query: 303 FFFFFNVSYPYLESVCFIAINKIL 232 FF+++ S+ YL+SV + +L Sbjct: 271 FFYYYGFSFNYLDSVVSVRSGTVL 294 >SPBC13A2.04c |||PTR family peptide transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 169 FYLEINVQNIPFVSSLSKLISQNFIYSY 252 FY INV ++ +++ S ++ F+Y+Y Sbjct: 250 FYWSINVGSLSVLATTSLESTKGFVYAY 277 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 114 HKLKLIVISICLLLDKKMFLFGNKCTEH-PLCI 209 H + ++++ L L K M L N C EH PL I Sbjct: 934 HNNQSLLLAASLTLSKFMCLSNNFCMEHLPLLI 966 >SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 197 SPLYLHFPNLYLRIL 241 +PLY HF N Y+R L Sbjct: 132 APLYNHFDNFYVRRL 146 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 23.4 bits (48), Expect = 7.7 Identities = 21/64 (32%), Positives = 34/64 (53%) Frame = -2 Query: 208 IQRGCSVHLFPNKNIFLSSNKQIEITISFNLCFTNIFN*NIFKLPKK*INSKIILTSHLL 29 I G SV L P+ FLSSN + ++C++ IF+ ++ L + ++ +L S L Sbjct: 622 ILSGSSVDL-PSAE-FLSSNLTDALYSGSSICYSLIFSHSLLDLTFQYVDIASLL-SQFL 678 Query: 28 LKVY 17 L VY Sbjct: 679 LCVY 682 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,183,490 Number of Sequences: 5004 Number of extensions: 21991 Number of successful extensions: 49 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 77794588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -