BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1241 (305 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17915| Best HMM Match : 7tm_1 (HMM E-Value=6e-30) 26 5.3 SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_49880| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.2 >SB_17915| Best HMM Match : 7tm_1 (HMM E-Value=6e-30) Length = 387 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 270 LESVCFIAINKILRYKFGK*RYKGDVLYIYFQIKTFFC 157 + S +N +L K K RY+ +Y+ QI FFC Sbjct: 302 MASFLHAVVNPLLYGKMSK-RYRRGYIYVMKQIVAFFC 338 >SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 25.8 bits (54), Expect = 7.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 196 CSVHLFPNKNIFLSSNKQIEITISFNLCFTN 104 C FP + + L Q++ +SF LC+ N Sbjct: 887 CFALHFPERQLLLHLKVQLKRLVSFGLCYYN 917 >SB_49880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 25.4 bits (53), Expect = 9.2 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 187 VQNIPFVSSLSKLISQNFIYSY 252 V P+VS+LSK++ +F Y+Y Sbjct: 253 VSKPPYVSNLSKVLMYDFHYNY 274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,742,784 Number of Sequences: 59808 Number of extensions: 129868 Number of successful extensions: 229 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 229 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 377252670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -