BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1241 (305 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 2.6 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 3.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 3.4 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 20 6.0 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 20 6.0 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.4 bits (43), Expect = 2.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 163 FLSSNKQIEITISFNLC 113 FL N + ++ +SF LC Sbjct: 125 FLHVNDECDVALSFKLC 141 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 3.4 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 190 VHLFPNKNIFLSSNKQIEITISFNLCFTNI 101 + L P KN + + +TI F F N+ Sbjct: 533 ITLQPGKNTIEQKSTKSSVTIPFERTFRNL 562 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.0 bits (42), Expect = 3.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 125 ANSNFYLLITRQKNVFIW 178 A NFY + KNV +W Sbjct: 99 ALGNFYFVHESLKNVLLW 116 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 83 KNVLIKNVCEAQIKANSNFYLLITRQKNVF 172 +NV+ K V E + +++N Y+ + F Sbjct: 94 ENVIKKLVAECSVISDANIYIRFNKLVKCF 123 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 83 KNVLIKNVCEAQIKANSNFYLLITRQKNVF 172 +NV+ K V E + +++N Y+ + F Sbjct: 94 ENVIKKLVAECSVISDANIYIRFNKLVKCF 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,348 Number of Sequences: 438 Number of extensions: 1275 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6493812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -