BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1240 (533 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.05 |||mitochondrial RNA-binding protein |Schizosaccharomy... 25 5.4 SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha... 25 9.4 >SPBC83.05 |||mitochondrial RNA-binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.4 bits (53), Expect = 5.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 16 LITATPDLKIGGGKNLNQVVGFSEHSVVLLGE 111 ++ TPD +GG K+L Q V E+ +LLG+ Sbjct: 503 VLMLTPD--VGGTKSLEQYVNGWENRTLLLGD 532 >SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase Alg10|Schizosaccharomyces pombe|chr 1|||Manual Length = 445 Score = 24.6 bits (51), Expect = 9.4 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -3 Query: 231 LLEVGRRENVASGAFNKVHA*IVSLLERSSQSFRIFSLFLLAKQHDGMLTESNDLIQI 58 L+ RR + S F+K IVS+L + IF F+LA + N L +I Sbjct: 279 LMSHSRRSKLLSAVFSKKSFLIVSVLLLIAHFNTIFHPFILADNRHYLFYVFNRLFRI 336 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,940,628 Number of Sequences: 5004 Number of extensions: 34012 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -