BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1240 (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08850.2 68417.m01455 leucine-rich repeat family protein / pr... 32 0.28 At5g38360.1 68418.m04630 esterase/lipase/thioesterase family pro... 29 1.5 At3g05820.1 68416.m00653 beta-fructofuranosidase, putative / inv... 29 1.5 At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) co... 27 5.9 At4g08850.1 68417.m01454 leucine-rich repeat family protein / pr... 27 5.9 At2g26430.1 68415.m03171 ania-6a type cyclin (RCY1) nearly ident... 27 5.9 At3g58110.1 68416.m06480 expressed protein 27 7.9 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 27 7.9 At2g42370.1 68415.m05243 expressed protein 27 7.9 >At4g08850.2 68417.m01455 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1009 Score = 31.9 bits (69), Expect = 0.28 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +1 Query: 97 VLLGEKKQTKDSETLRGTLQKTDDSCVNFVEGTGGYVFSSTNFEKLN 237 +LLGE + K S+ L K D S + V GT GYV T F+ L+ Sbjct: 911 ILLGEDYEAKISDFGTAKLLKPDSSNWSAVAGTYGYVAPGTLFDPLD 957 >At5g38360.1 68418.m04630 esterase/lipase/thioesterase family protein low similarity to SP|P49323 Non-heme chloroperoxidase (EC 1.11.1.10) (Chloride peroxidase) {Streptomyces lividans}; contains Interpro entry IPR000379 Length = 242 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 76 GFSEHSVVLLGEKKQTKDSETLRGTLQKTDDSCVNFVEGTGG 201 GF ++V LLG+ + + T+ GTLQ +F+E G Sbjct: 94 GFDSYAVSLLGQGESDEPLGTVAGTLQTHASDIADFIESNLG 135 >At3g05820.1 68416.m00653 beta-fructofuranosidase, putative / invertase, putative / saccharase, putative / beta-fructosidase, putative similar to neutral invertase [Daucus carota] GI:4200165; contains Pfam profile PF04853: Plant neutral invertase Length = 633 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 167 SSVFWSVPLKVSESLVCFFSPSSTTECS 84 SS+FW L++ ES VC + S +CS Sbjct: 596 SSLFWEEDLELLESCVCVLTKSGRKKCS 623 >At5g42400.1 68418.m05162 SET domain-containing protein (TXR7) contains Pfam profile PF00856: SET domain Length = 1423 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 429 DDLDFTDAPTSACEKSLSYPCLRRQSEP 346 D L + P CE +++ PCLR + +P Sbjct: 672 DALAIHEPPPPGCESNINMPCLRYKYQP 699 >At4g08850.1 68417.m01454 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1045 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 97 VLLGEKKQTKDSETLRGTLQKTDDSCVNFVEGTGGYV 207 +LLGE + K S+ L K D S + V GT GYV Sbjct: 911 ILLGEDYEAKISDFGTAKLLKPDSSNWSAVAGTYGYV 947 >At2g26430.1 68415.m03171 ania-6a type cyclin (RCY1) nearly identical to ania-6a type cyclin [Arabidopsis thaliana] GI:13924511 Length = 416 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 4 VTTSLITATPDLKIGGGKNLNQVVGFSEHSVVLLGEKKQTKDSETLRG 147 VTT AT K G N +VG S + +G++++ D E RG Sbjct: 301 VTTPHEKATDSKKSGTESNSQPIVGDSSYERSKVGDRERESDREKERG 348 >At3g58110.1 68416.m06480 expressed protein Length = 784 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 184 VEGTGGYVFSSTNFEKLNAPQQK 252 V+G+GG V S+T EKL Q++ Sbjct: 687 VKGSGGLVLSTTEIEKLRLKQEE 709 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/66 (21%), Positives = 35/66 (53%) Frame = -3 Query: 231 LLEVGRRENVASGAFNKVHA*IVSLLERSSQSFRIFSLFLLAKQHDGMLTESNDLIQILS 52 +L +G N + + + + SLL+ + R +F+LA++ G+L D++ + + Sbjct: 295 ILSLGNALNHGTARGSAIGFHLDSLLKLTDTRSRNIFIFVLAEKLPGLLNFPKDMVSLEA 354 Query: 51 TSNLEV 34 +N+++ Sbjct: 355 ATNIQL 360 >At2g42370.1 68415.m05243 expressed protein Length = 715 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 184 VEGTGGYVFSSTNFEKLNAPQQK 252 V+GTGG V S+ EKL ++K Sbjct: 624 VKGTGGLVLSTAEIEKLRLKEEK 646 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,384,560 Number of Sequences: 28952 Number of extensions: 186410 Number of successful extensions: 452 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -