BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1238 (308 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pom... 26 1.1 SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Sch... 25 3.4 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 25 3.4 >SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 107 KNIFLYTLSRLDVCMCVLTNRFVR 36 K IF++ LS L + +C +T RF+R Sbjct: 63 KIIFIFQLSILTLYICCITFRFIR 86 >SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 24.6 bits (51), Expect = 3.4 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -1 Query: 254 SPWKSIVNIC*VRYFIRKIGTRLRFEYR 171 SP + ++N+ Y + +G +RF +R Sbjct: 179 SPSRPVINVSFFNYIFQNLGWLIRFSFR 206 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 24.6 bits (51), Expect = 3.4 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 204 KNWYPPEIRIPVHSLTRMHRTSYPLGLRYS 115 +N+ P E IP + R++RTS+ GLRYS Sbjct: 311 QNFEPGENLIPSRNDGRINRTSH--GLRYS 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,329,802 Number of Sequences: 5004 Number of extensions: 26363 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 79841814 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -