BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1238 (308 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB002293-1|BAA20755.1| 981|Homo sapiens KIAA0295 protein. 28 4.8 AK128711-1|BAC87585.1| 206|Homo sapiens protein ( Homo sapiens ... 27 8.5 >AB002293-1|BAA20755.1| 981|Homo sapiens KIAA0295 protein. Length = 981 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 189 PEIRIPVHSLTRMHRTSYPLGLRYSIFEKYFPIHP 85 P + +PV S H++ P YS + Y P HP Sbjct: 778 PSVHVPVSSPLTQHQSYIPYMHGYSYSQSYDPNHP 812 >AK128711-1|BAC87585.1| 206|Homo sapiens protein ( Homo sapiens cDNA FLJ46878 fis, clone UTERU3014906. ). Length = 206 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = -3 Query: 276 FYYSMLFLTVEVNREHLLSTVFH*KNWYPPEIRIPVHSLTRMHRTSY-PLGLRYSIFEKY 100 +Y+ + + ++ L+ST P I HS H ++ L L SI Sbjct: 34 YYFIHPSIPLSLHPTILISTHLFAHTSIHPTIHPSAHSSNHAHILAFIHLSLLSSIHTSI 93 Query: 99 FP-IHPISSRCVHVCTYQSL 43 P IHP + +H+C + S+ Sbjct: 94 HPPIHPSTHPSIHLCIHSSI 113 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,274,027 Number of Sequences: 237096 Number of extensions: 859130 Number of successful extensions: 1296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 76,859,062 effective HSP length: 78 effective length of database: 58,365,574 effective search space used: 1400773776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -