BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1238 (308 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 25 0.16 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 0.48 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 2.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 2.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 4.5 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 25.4 bits (53), Expect = 0.16 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 125 LGIRYLKNIFLYTLSRLDVCMCVLTNRFVRRV 30 +G +L IFL + VC+ + T+R +RR+ Sbjct: 28 VGFLFLILIFLSVAGNILVCVAIYTDRGLRRI 59 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.8 bits (49), Expect = 0.48 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 70 TSRRDRVYRKIFFKYRIPKA*RIRRP 147 T R ++ RKIF KY +P +RRP Sbjct: 327 THRMPQLIRKIFLKY-LPTILMMRRP 351 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 2.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 184 LRRVPIFLMKYRTQQMFTI 240 L VP+FLM+ QM TI Sbjct: 67 LAGVPMFLMELSLGQMMTI 85 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 2.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 184 LRRVPIFLMKYRTQQMFTI 240 L VP+FLM+ QM TI Sbjct: 120 LAGVPMFLMELSLGQMMTI 138 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.6 bits (41), Expect = 4.5 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 264 YYNKNQTRKIIFSCN 308 YYN N +K+ ++ N Sbjct: 317 YYNNNNYKKLYYNIN 331 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,592 Number of Sequences: 438 Number of extensions: 2147 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6471036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -