BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1237 (605 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_46656| Best HMM Match : A2M (HMM E-Value=5.8e-39) 27 8.9 >SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1569 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -2 Query: 145 EVSTDNKFFEFEIRGINLNKLISNPIQHPNHEFEEIEINVLKNRI 11 E +T K F+ NL+KL+ ++HP+ + + I ++K + Sbjct: 24 EKATQTKVFDLSYTDENLDKLVGQWLEHPSRKNTDKVIKLVKGGV 68 >SB_46656| Best HMM Match : A2M (HMM E-Value=5.8e-39) Length = 319 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 148 NEVSTDNKFFEFEIRGINLNKLISNP 71 N +S +NK ++++ R N KL +NP Sbjct: 294 NNISNNNKSYKYKYRNTNKAKLTANP 319 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,740,944 Number of Sequences: 59808 Number of extensions: 101748 Number of successful extensions: 183 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -