BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1236 (570 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 6.5 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 8.6 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 141 IINKNCQTRHPLKF*IDDEFFGTF 212 II + + P+ IDDEF GT+ Sbjct: 262 IIYLSAKGHRPIDDNIDDEFKGTY 285 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 475 IFFIFFQS*KTCGKTILHVLYCVSVGFVSFHFLYI 371 IFF KT T+ ++ CVS+ ++S Y+ Sbjct: 225 IFFNITLRRKTLFYTVNLIVPCVSISYLSVLAFYL 259 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,763 Number of Sequences: 438 Number of extensions: 2642 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -