BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1235 (402 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A... 110 3e-25 At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S... 110 3e-25 At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A... 110 3e-25 At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497... 110 3e-25 At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496... 110 3e-25 At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A... 110 3e-25 At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A... 106 6e-24 At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A... 106 6e-24 At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A... 106 6e-24 At2g42100.1 68415.m05205 actin, putative very strong similarity ... 102 8e-23 At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac... 74 4e-14 At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara... 68 2e-12 At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identica... 57 4e-09 At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id... 57 5e-09 At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i... 54 4e-08 At3g12380.1 68416.m01543 actin/actin-like family protein similar... 44 4e-05 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 38 0.002 At5g01040.1 68418.m00007 laccase family protein / diphenol oxida... 34 0.041 At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i... 33 0.094 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 30 0.66 At1g16690.2 68414.m01999 transcription factor-related similar to... 28 2.7 At1g16690.1 68414.m01998 transcription factor-related similar to... 28 2.7 At5g06610.1 68418.m00747 expressed protein contains Pfam profile... 27 3.5 At4g30070.1 68417.m04277 plant defensin-fusion protein, putative... 27 3.5 At5g49190.1 68418.m06088 sucrose synthase / sucrose-UDP glucosyl... 27 4.7 At5g45620.2 68418.m05607 26S proteasome regulatory subunit, puta... 27 6.2 At5g45620.1 68418.m05608 26S proteasome regulatory subunit, puta... 27 6.2 At4g19006.1 68417.m02801 26S proteasome regulatory subunit, puta... 27 6.2 At5g66360.2 68418.m08367 ribosomal RNA adenine dimethylase famil... 26 8.2 At5g66360.1 68418.m08366 ribosomal RNA adenine dimethylase famil... 26 8.2 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 26 8.2 At4g02280.1 68417.m00309 sucrose synthase, putative / sucrose-UD... 26 8.2 At3g50480.1 68416.m05521 broad-spectrum mildew resistance RPW8 f... 26 8.2 At3g48860.2 68416.m05337 expressed protein 26 8.2 At3g48860.1 68416.m05336 expressed protein 26 8.2 At3g07870.1 68416.m00962 F-box family protein contains F-box dom... 26 8.2 At2g41890.1 68415.m05181 curculin-like (mannose-binding) lectin ... 26 8.2 >At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 Actin 4 {Arabidopsis thaliana} Length = 377 Score = 110 bits (265), Expect = 3e-25 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 E++ LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK Sbjct: 5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63 Score = 78.6 bits (185), Expect = 1e-15 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHGIV NWDDMEKIWH+TFYNE V+P Sbjct: 63 KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP 100 Score = 33.5 bits (73), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHPVLLTEAP Sbjct: 98 VAPEEHPVLLTEAP 111 >At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana} Length = 377 Score = 110 bits (265), Expect = 3e-25 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 E++ LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK Sbjct: 5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63 Score = 79.0 bits (186), Expect = 1e-15 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHGIV+NWDDMEKIWH+TFYNE V+P Sbjct: 63 KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP 100 Score = 33.5 bits (73), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHPVLLTEAP Sbjct: 98 VAPEEHPVLLTEAP 111 >At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 Actin 3 {Arabidopsis thaliana}; supported by full-length cDNA: Ceres: 19581. Length = 377 Score = 110 bits (265), Expect = 3e-25 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 E++ LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK Sbjct: 5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63 Score = 78.6 bits (185), Expect = 1e-15 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHGIV NWDDMEKIWH+TFYNE V+P Sbjct: 63 KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP 100 Score = 33.1 bits (72), Expect = 0.071 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHP+LLTEAP Sbjct: 98 VAPEEHPILLTEAP 111 >At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497 Actin 12 {Arabidopsis thaliana} Length = 377 Score = 110 bits (265), Expect = 3e-25 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 E++ LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK Sbjct: 5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63 Score = 78.6 bits (185), Expect = 1e-15 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHGIV NWDDMEKIWH+TFYNE V+P Sbjct: 63 KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP 100 Score = 33.5 bits (73), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHPVLLTEAP Sbjct: 98 VAPEEHPVLLTEAP 111 >At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496 Actin 11 {Arabidopsis thaliana} Length = 377 Score = 110 bits (265), Expect = 3e-25 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 E++ LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK Sbjct: 5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63 Score = 79.0 bits (186), Expect = 1e-15 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHGIV+NWDDMEKIWH+TFYNE V+P Sbjct: 63 KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAP 100 Score = 33.5 bits (73), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHPVLLTEAP Sbjct: 98 VAPEEHPVLLTEAP 111 >At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 Actin 1 (Actin 3) {Arabidopsis thaliana} Length = 377 Score = 110 bits (265), Expect = 3e-25 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 E++ LV DNG+GM KAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+YVGDEAQSK Sbjct: 5 EDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSK 63 Score = 78.6 bits (185), Expect = 1e-15 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHGIV NWDDMEKIWH+TFYNE V+P Sbjct: 63 KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP 100 Score = 33.1 bits (72), Expect = 0.071 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHP+LLTEAP Sbjct: 98 VAPEEHPILLTEAP 111 >At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 377 Score = 106 bits (254), Expect = 6e-24 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 +++ +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSK Sbjct: 5 DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63 Score = 78.2 bits (184), Expect = 2e-15 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHG+V+NWDDMEKIWH+TFYNE ++P Sbjct: 63 KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAP 100 Score = 33.1 bits (72), Expect = 0.071 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 +APEEHPVLLTEAP Sbjct: 98 IAPEEHPVLLTEAP 111 >At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 371 Score = 106 bits (254), Expect = 6e-24 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 +++ +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSK Sbjct: 5 DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63 Score = 78.2 bits (184), Expect = 2e-15 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHG+V+NWDDMEKIWH+TFYNE ++P Sbjct: 63 KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAP 100 Score = 33.1 bits (72), Expect = 0.071 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 +APEEHPVLLTEAP Sbjct: 98 IAPEEHPVLLTEAP 111 >At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 Actin 8 {Arabidopsis thaliana}; nearly identical to SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and to At3g18780 Length = 377 Score = 106 bits (254), Expect = 6e-24 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 +++ +V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH GVMVGM QKD+YVGDEAQSK Sbjct: 5 DDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSK 63 Score = 78.2 bits (184), Expect = 2e-15 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGILTLKYPIEHG+V+NWDDMEKIWH+TFYNE ++P Sbjct: 63 KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAP 100 Score = 33.1 bits (72), Expect = 0.071 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 +APEEHPVLLTEAP Sbjct: 98 IAPEEHPVLLTEAP 111 >At2g42100.1 68415.m05205 actin, putative very strong similarity to SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493 Actin 3 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 378 Score = 102 bits (245), Expect = 8e-23 Identities = 44/59 (74%), Positives = 54/59 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255 +E A+V DNG+GM KAGFAGDDAPRAVFPS+VGRPRH+GVMVGM +KD++VGDEAQ++ Sbjct: 6 DESVAIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHRGVMVGMDEKDTFVGDEAQAR 64 Score = 75.4 bits (177), Expect = 1e-14 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +RGIL+LKYPIEHG+V+NWDDMEKIWH+TFYNE + P Sbjct: 64 RRGILSLKYPIEHGVVSNWDDMEKIWHHTFYNELRLEP 101 Score = 29.9 bits (64), Expect = 0.66 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +2 Query: 365 PEEHPVLLTEAP 400 PEEHP+LLTEAP Sbjct: 101 PEEHPILLTEAP 112 >At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin 11 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 366 Score = 73.7 bits (173), Expect = 4e-14 Identities = 35/56 (62%), Positives = 37/56 (66%) Frame = +3 Query: 198 RDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 RDG E + G R ILTLK P+EHGIV NWDDMEKIWHYTFYNE V P Sbjct: 35 RDGLNPNESYVGEE-GHANRDILTLKDPMEHGIVNNWDDMEKIWHYTFYNELRVDP 89 Score = 59.7 bits (138), Expect = 7e-10 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = +1 Query: 94 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252 +V D G GM +AGFAGD+AP+ VFP +VGRPR G+ +SYVG+E + Sbjct: 4 IVCDKGHGMVQAGFAGDEAPKVVFPCVVGRPRD-----GLNPNESYVGEEGHA 51 Score = 31.1 bits (67), Expect = 0.29 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 V PEEHPVLLTEAP Sbjct: 87 VDPEEHPVLLTEAP 100 >At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Arabidopsis thaliana] gi|9293903|dbj|BAB01806 Length = 329 Score = 68.1 bits (159), Expect = 2e-12 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +3 Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 GILTL YP+EHG+V+NWDDMEKIW++TFY+E V+P Sbjct: 20 GILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAP 55 Score = 33.5 bits (73), Expect = 0.054 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 359 VAPEEHPVLLTEAP 400 VAPEEHPVLLTEAP Sbjct: 53 VAPEEHPVLLTEAP 66 Score = 26.6 bits (56), Expect = 6.2 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 202 MVGMGQKDSYVGDEAQSK 255 MVGM + D +VGD+A+++ Sbjct: 1 MVGMNENDLFVGDDAEAR 18 >At1g73910.1 68414.m08559 actin-related protein 5 (ARP5) identical to actin-related protein 5 (ARP5) GI:21489922 from [Arabidopsis thaliana] Length = 145 Score = 57.2 bits (132), Expect = 4e-09 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180 +EV+A+VVD GS CKAG+AG+DAP+AVFPS+VG Sbjct: 5 DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVVG 38 Score = 32.7 bits (71), Expect = 0.094 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +R + + P + GIVT+WD ++ +W + F N + P Sbjct: 79 RRDQMEILSPTKDGIVTDWDMVDNVWDHAFRNCLMIDP 116 >At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary identical to actin-related protein 4 (ARP4) [Arabidopsis thaliana] GI:21427463; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427462|gb|AF507912.1| Length = 441 Score = 56.8 bits (131), Expect = 5e-09 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180 +EV+A+VVD GS CKAG+AG+DAP+AVFPS++G Sbjct: 5 DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 38 Score = 31.1 bits (67), Expect = 0.29 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 279 PIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 PI+ GIV++WD ++ IW + F + + P Sbjct: 94 PIKDGIVSDWDLVDNIWEHAFKSCLMIDP 122 >At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly identical to actin-related protein 2 (ARP2) [Arabidopsis thaliana] GI:3818624; contains Pfam profile PF00022: Actin Length = 389 Score = 54.0 bits (124), Expect = 4e-08 Identities = 20/40 (50%), Positives = 28/40 (70%) Frame = +3 Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSP 365 +E R L + YP+ +GIV NWDDME +W + FYNE ++P Sbjct: 60 SELRHQLDINYPVHNGIVQNWDDMEHVWDHAFYNELKINP 99 Score = 49.2 bits (112), Expect = 1e-06 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%) Frame = +1 Query: 94 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGD 240 +V DNG+G K GFAG++ P +VFP +VGRP R++ ++ KD VG+ Sbjct: 7 VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLMEQQVKDIVVGE 57 >At3g12380.1 68416.m01543 actin/actin-like family protein similar to SP|P53946 Actin-like protein ARP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00022: Actin Length = 724 Score = 44.0 bits (99), Expect = 4e-05 Identities = 21/49 (42%), Positives = 31/49 (63%) Frame = +1 Query: 94 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 240 +V+DNG+ + G+AG+ PR VF +IV RPRH+ G+ + VGD Sbjct: 22 IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 38.3 bits (85), Expect = 0.002 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 270 LKYPIEHGIVTNWDDMEKIWHYTFYN 347 L YPIEHG V +WD ME+ W +N Sbjct: 86 LHYPIEHGQVEDWDAMERYWQQCIFN 111 Score = 35.9 bits (79), Expect = 0.010 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 91 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177 A+V+DNG+G K GFAG+ P + P++V Sbjct: 8 AIVIDNGTGYTKMGFAGNVEPCFILPTVV 36 >At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661201], lac110 laccase, Populus trichocarpa, EMBL:PTY13773 Length = 584 Score = 33.9 bits (74), Expect = 0.041 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = -2 Query: 215 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 78 P P I P RGL +G T+ +SSPA+P + +P +ST + TS+ Sbjct: 290 PTPDIKP-TRGLIVYQGATS--SSSPAEPLMPVPNDMSTAHRFTSN 332 >At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly identical to actin-related protein 6 (ARP6) [Arabidopsis thaliana] GI:21427467; contains Pfam profile PF00022: Actin Length = 421 Score = 32.7 bits (71), Expect = 0.094 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 94 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186 +V+DNG G+ KAG G+ P V P+ + +P Sbjct: 5 VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 29.9 bits (64), Expect = 0.66 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 279 PIEHGIVTNWDDMEKIWHYTFY 344 PIE G++ +WD ME + Y Y Sbjct: 57 PIERGLIRDWDAMEDLLRYVVY 78 Score = 27.5 bits (58), Expect = 3.5 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 91 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGR 183 ALVVD GS KAG A D +P + PS + R Sbjct: 3 ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR 34 >At1g16690.2 68414.m01999 transcription factor-related similar to enhancer of polycomb (GI:11907923)[Homo sapiens] Length = 439 Score = 27.9 bits (59), Expect = 2.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 264 LTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSPPRN 374 L++KY + H I + W + +IW PP N Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPPPVN 214 >At1g16690.1 68414.m01998 transcription factor-related similar to enhancer of polycomb (GI:11907923)[Homo sapiens] Length = 439 Score = 27.9 bits (59), Expect = 2.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 264 LTLKYPIEHGIVTNWDDMEKIWHYTFYNEPAVSPPRN 374 L++KY + H I + W + +IW PP N Sbjct: 178 LSIKYGVFHAIYSYWKNKREIWQKPILRRLQPPPPVN 214 >At5g06610.1 68418.m00747 expressed protein contains Pfam profile PF04788: Protein of unknown function (DUF620) Length = 368 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -2 Query: 191 WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 69 WR P + + A+GA P + AL +PL+ ++ +S+ + Sbjct: 167 WRYTPWLGDHAAKGAIRPLRRALQGLDPLTISSVFSSAQFV 207 >At4g30070.1 68417.m04277 plant defensin-fusion protein, putative contains a C-terminal plant defensin domain, personal communication, Bart Thomma (Bart.Thomma@agr.kuleuven.ac.be) Length = 129 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 268 VRIPLCSVPHLLHKSPSVPYRPSRPDGGA 182 V +PLC + PS P P + DGGA Sbjct: 59 VGVPLCKCYYECESPPSPPAPPKKCDGGA 87 >At5g49190.1 68418.m06088 sucrose synthase / sucrose-UDP glucosyltransferase (SUS2) nearly identical to SP|Q00917 Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase) {Arabidopsis thaliana} (SUS2); contains Pfam profile: PF00862 sucrose synthase Length = 807 Score = 27.1 bits (57), Expect = 4.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 243 GTEQRGILTLKYPIEHGIVTNWDDMEKIWHY 335 GTE IL + + E GI+ W +W Y Sbjct: 355 GTEHAHILRIPFRTEKGILRKWISRFDVWPY 385 >At5g45620.2 68418.m05607 26S proteasome regulatory subunit, putative (RPN9) contains similarity to 26S proteasome subunit p40.5 GI:3618343 from [Homo sapiens] Length = 350 Score = 26.6 bits (56), Expect = 6.2 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 325 IFSMSSQLVTIPCSMGYLRVRIPLCSVPHLLHKSPSV 215 IFS ++ TIP S+ R ++ + V HLL KS SV Sbjct: 290 IFSRPAEDRTIPLSIIAERTKLSIEDVEHLLMKSLSV 326 >At5g45620.1 68418.m05608 26S proteasome regulatory subunit, putative (RPN9) contains similarity to 26S proteasome subunit p40.5 GI:3618343 from [Homo sapiens] Length = 386 Score = 26.6 bits (56), Expect = 6.2 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 325 IFSMSSQLVTIPCSMGYLRVRIPLCSVPHLLHKSPSV 215 IFS ++ TIP S+ R ++ + V HLL KS SV Sbjct: 290 IFSRPAEDRTIPLSIIAERTKLSIEDVEHLLMKSLSV 326 >At4g19006.1 68417.m02801 26S proteasome regulatory subunit, putative (RPN9) similar to 26S proteasome subunit p40.5 [Homo sapiens] gi|3618343|dbj|BAA33214 Length = 386 Score = 26.6 bits (56), Expect = 6.2 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 325 IFSMSSQLVTIPCSMGYLRVRIPLCSVPHLLHKSPSV 215 IFS ++ TIP S+ R ++ + V HLL KS SV Sbjct: 290 IFSRPAEDRTIPLSVIAERTKLSIEDVEHLLMKSLSV 326 >At5g66360.2 68418.m08367 ribosomal RNA adenine dimethylase family protein similar to SP|P41819 Dimethyladenosine transferase (EC 2.1.1.-) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) {Saccharomyces cerevisiae}; contains Pfam profile PF00398: ribosomal RNA adenine dimethylase family protein Length = 380 Score = 26.2 bits (55), Expect = 8.2 Identities = 14/61 (22%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 237 SYIRVLLSHTDHHA-LMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFVAHLEL 61 SY+ L+ D H+ P HDR G + E H G + +G + + + Sbjct: 18 SYLSSLVFRRDSHSQARTKPDHDRRRRGYERDVRIEEKKEHDGLFLCKSKGQHLLTNTRI 77 Query: 60 V 58 + Sbjct: 78 L 78 >At5g66360.1 68418.m08366 ribosomal RNA adenine dimethylase family protein similar to SP|P41819 Dimethyladenosine transferase (EC 2.1.1.-) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) {Saccharomyces cerevisiae}; contains Pfam profile PF00398: ribosomal RNA adenine dimethylase family protein Length = 352 Score = 26.2 bits (55), Expect = 8.2 Identities = 14/61 (22%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 237 SYIRVLLSHTDHHA-LMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFVAHLEL 61 SY+ L+ D H+ P HDR G + E H G + +G + + + Sbjct: 18 SYLSSLVFRRDSHSQARTKPDHDRRRRGYERDVRIEEKKEHDGLFLCKSKGQHLLTNTRI 77 Query: 60 V 58 + Sbjct: 78 L 78 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 353 RLIVEGIMPNLLHVIPVSNDSVFDGVFEGQDTSL 252 R + +G++PNLL V+P + S+ V+E SL Sbjct: 453 RALYKGLLPNLLKVVPAA--SITYMVYEAMKKSL 484 >At4g02280.1 68417.m00309 sucrose synthase, putative / sucrose-UDP glucosyltransferase, putative strong similarity to sucrose synthase GI:6682841 from [Citrus unshiu] Length = 809 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 243 GTEQRGILTLKYPIEHGIVTNWDDMEKIWHY 335 GTE IL + + E GI+ W +W Y Sbjct: 358 GTEHTHILRVPFRSEKGILRKWISRFDVWPY 388 >At3g50480.1 68416.m05521 broad-spectrum mildew resistance RPW8 family protein contains Pfam PF05659: Arabidopsis broad-spectrum mildew resistance protein RPW8 Length = 200 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 329 PNLLHVIPVSNDSVFDGVFEGQDTSLLCASSPT*ESFCPI 210 P + + V ++DG +G+DTS++ T ES P+ Sbjct: 15 PLIAAALGVGAQVIYDGFRKGKDTSIINRLGRTMESISPV 54 >At3g48860.2 68416.m05337 expressed protein Length = 577 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 170 EGNTARGASSPAKPALHIPEPLSTTNAATSSSH 72 E + R AS+ KPA H P +S+T + +S+ + Sbjct: 82 EDLSLRFASASLKPARHAPSSISSTGSNSSNGN 114 >At3g48860.1 68416.m05336 expressed protein Length = 494 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 170 EGNTARGASSPAKPALHIPEPLSTTNAATSSSH 72 E + R AS+ KPA H P +S+T + +S+ + Sbjct: 82 EDLSLRFASASLKPARHAPSSISSTGSNSSNGN 114 >At3g07870.1 68416.m00962 F-box family protein contains F-box domain Pfam:PF00646 Length = 417 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -2 Query: 191 WRGLPTIEGNTARGASSPAKPA--LHIPEPL 105 WR + T G + +SSP KP LH P+ Sbjct: 55 WRSVLTQHGRLSSSSSSPTKPCLLLHCDSPI 85 >At2g41890.1 68415.m05181 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein contains Pfam profiles: PF01453 lectin (probable mannose binding), PF00024 PAN domain Length = 764 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 79 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM 204 E++ A + + G G+C A +D + V I GR +GV+ Sbjct: 632 EDLEAKLTEYGFGLCAADKDVEDFGKTVLALITGRYEPEGVV 673 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,733,089 Number of Sequences: 28952 Number of extensions: 218152 Number of successful extensions: 659 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -