BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1234 (380 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 41 0.007 UniRef50_Q0S208 Cluster: Polyribonucleotide nucleotidyltransfera... 33 1.8 UniRef50_A4I495 Cluster: Putative uncharacterized protein; n=3; ... 32 3.2 UniRef50_A7T0K2 Cluster: Predicted protein; n=4; Nematostella ve... 31 5.5 UniRef50_A1D140 Cluster: Plasma membrane ferric-chelate reductas... 31 7.3 UniRef50_A0VUL4 Cluster: Glycosyl transferase, group 1; n=1; Din... 31 9.6 UniRef50_Q2NPD0 Cluster: Putative uncharacterized protein; n=1; ... 31 9.6 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 41.1 bits (92), Expect = 0.007 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -2 Query: 379 WVDELRAYLGVRWLLEPIDIYDVNAPPTLRY 287 WVDEL A+L + P +YDVNAPPT RY Sbjct: 159 WVDELTAHLVLSGYWSPRHLYDVNAPPTSRY 189 >UniRef50_Q0S208 Cluster: Polyribonucleotide nucleotidyltransferase; n=18; Actinomycetales|Rep: Polyribonucleotide nucleotidyltransferase - Rhodococcus sp. (strain RHA1) Length = 757 Score = 33.1 bits (72), Expect = 1.8 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -2 Query: 337 LEPIDIYDVNAPPTLRYSSKVSSIVITAPRLSNRNALLLHGRNRAGRW 194 L P D+YDV A S++++ + + P R AL+ N+AG+W Sbjct: 135 LNPQDLYDVVAINAASASTQIAGLPFSGPVGGVRVALITSDENKAGQW 182 >UniRef50_A4I495 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania infantum Length = 578 Score = 32.3 bits (70), Expect = 3.2 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -2 Query: 367 LRAYLGVRWLL-EPIDIYDVNAPPTLRYSSKVSSIVITAPRLSNRNALLLHGRNRAGRWY 191 LRA L W + +D Y V PP S ++ V T P L L H R G Sbjct: 450 LRAPLAEMWQSRQAVDAYHV--PPAQERVSLLAQKVATRPMLRTPTPLQ-HDRQHGGTGS 506 Query: 190 LPTRTHRVLP 161 P R HR++P Sbjct: 507 EPLRPHRIVP 516 >UniRef50_A7T0K2 Cluster: Predicted protein; n=4; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 398 Score = 31.5 bits (68), Expect = 5.5 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = -2 Query: 370 ELRAYLGVRWLLEPIDIYDVNAPPTLRYSSKVSSIVITAPRLSNRNALLLHGRNRA 203 EL G W + ++ +D+N P S SS + P+L+++ A++ H NRA Sbjct: 159 ELFQKQGSGWQFDQVEYFDINIDPFEPLSG--SSYIPLPPKLASKKAVINHFANRA 212 >UniRef50_A1D140 Cluster: Plasma membrane ferric-chelate reductase (Fre2), putative; n=3; Trichocomaceae|Rep: Plasma membrane ferric-chelate reductase (Fre2), putative - Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181)) Length = 743 Score = 31.1 bits (67), Expect = 7.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 298 WVAHLRRRCLWAPVTT*HPNRL 363 W HLR +CL +P T HPN L Sbjct: 558 WTRHLRDQCLQSPTRTIHPNIL 579 >UniRef50_A0VUL4 Cluster: Glycosyl transferase, group 1; n=1; Dinoroseobacter shibae DFL 12|Rep: Glycosyl transferase, group 1 - Dinoroseobacter shibae DFL 12 Length = 1302 Score = 30.7 bits (66), Expect = 9.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 331 PIDIYDVNAPPTLRYSSKVSSIVITAPRLSNRNALLLHGRNR 206 P+ +YD APP L SSK +V + + +L +GR+R Sbjct: 418 PVIVYDHGAPPELVVSSKTGQVVPFGDIQAVADQVLAYGRDR 459 >UniRef50_Q2NPD0 Cluster: Putative uncharacterized protein; n=1; Xanthomonas phage OP2|Rep: Putative uncharacterized protein - Xanthomonas phage OP2 Length = 494 Score = 30.7 bits (66), Expect = 9.6 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -2 Query: 298 TLRYSSKVSSIVITAPRLSNRNALLLHGRNRAGRWYLPTRTHRV 167 TL S VSS + L+N NALL +G G++ T T+ V Sbjct: 311 TLALRSPVSSAGVRVDNLANANALLSNGYTYLGKYASATNTYTV 354 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 442,382,714 Number of Sequences: 1657284 Number of extensions: 9135463 Number of successful extensions: 18598 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18597 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 14868845845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -