BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1234 (380 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC002872-1|AAH02872.1| 339|Homo sapiens KIAA0515 protein protein. 29 5.0 AL358781-1|CAI40214.1| 1535|Homo sapiens KIAA0515 protein. 29 5.0 >BC002872-1|AAH02872.1| 339|Homo sapiens KIAA0515 protein protein. Length = 339 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 275 LKYSYNGAPPFKPKRITASRQK*GRAVVPTHADSQSPT 162 L SY P +P+ +T+ R+ GR ++ + S SPT Sbjct: 191 LDLSYGPGPSLRPQNVTSWREGGGRHIISATSLSTSPT 228 >AL358781-1|CAI40214.1| 1535|Homo sapiens KIAA0515 protein. Length = 1535 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 275 LKYSYNGAPPFKPKRITASRQK*GRAVVPTHADSQSPT 162 L SY P +P+ +T+ R+ GR ++ + S SPT Sbjct: 191 LDLSYGPGPSLRPQNVTSWREGGGRHIISATSLSTSPT 228 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,029,444 Number of Sequences: 237096 Number of extensions: 1430842 Number of successful extensions: 2150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2150 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2526356360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -