BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1232 (611 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces p... 26 4.9 SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosacch... 25 8.6 >SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 25.8 bits (54), Expect = 4.9 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 577 HGFSRLK-TEPSTKTTVDLYISIYKHFDILN 488 HG+S + T PS + L+ I+K FD LN Sbjct: 302 HGYSNIFITSPSPENLKTLFEFIFKGFDALN 332 >SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 25.0 bits (52), Expect = 8.6 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 459 FNLLRQKPNMD*GQQAAFWLSSEIVNVYEL**LASTEMWVRR 334 + + P M Q+A WL +I + L L E W+R+ Sbjct: 34 YKYTNRSPKMALNQEAYNWLREQIRGLRNLHLLPEEEQWLRK 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,586,391 Number of Sequences: 5004 Number of extensions: 53272 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -