BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1232 (611 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) 28 5.2 SB_29237| Best HMM Match : I-set (HMM E-Value=0) 28 5.2 SB_10606| Best HMM Match : I-set (HMM E-Value=0) 28 6.9 SB_12380| Best HMM Match : SAM_2 (HMM E-Value=1.6e-14) 27 9.1 >SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 564 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 390 SRTTAKMLPAVLNPCLVFALIG*IGTYIKPKIQ 488 SRT +L VL C +FAL+G + Y+ KIQ Sbjct: 519 SRTATNVLLIVLTACTIFALVGML--YLGRKIQ 549 >SB_29237| Best HMM Match : I-set (HMM E-Value=0) Length = 869 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -3 Query: 309 IVQENPESLLGPSTINTVMSSALNGVPTPLILWKPYQ 199 ++ E P+ + + V+ A GVP P ++W+ Q Sbjct: 408 VLTEEPKDMQAMEGLKVVLKCAAKGVPPPKLIWQRNQ 444 >SB_10606| Best HMM Match : I-set (HMM E-Value=0) Length = 872 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 276 PSTINTVMSSALNGVPTPLILW 211 P+ +TV+S + GVP P I+W Sbjct: 352 PADTSTVISCPIKGVPRPKIIW 373 >SB_12380| Best HMM Match : SAM_2 (HMM E-Value=1.6e-14) Length = 218 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 475 FI*VPI*PIKAKTKHGLRTAGSILAVV 395 F VP+ P K T HGL AG I+ VV Sbjct: 170 FCIVPLPPKKRTTTHGLLHAGKIVVVV 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,519,965 Number of Sequences: 59808 Number of extensions: 373168 Number of successful extensions: 632 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -