BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1229 (604 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0093 - 9108883-9109068,9109156-9109248,9109363-9109441,910... 28 5.0 09_02_0315 - 7179332-7179949 28 5.0 >10_05_0093 - 9108883-9109068,9109156-9109248,9109363-9109441, 9109529-9109639,9109715-9109857,9110050-9110522, 9110568-9111075,9111241-9111810,9111883-9112119, 9112196-9112465 Length = 889 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = -3 Query: 410 KTFVKKSNLKIINAAYFSREAVMRFGLKGGAAVVTILRP*NLSQGGWRIYVVMSMGSSNH 231 + F+ N ++I AAY ++ + F + A VVT+L P + S +R ++ + + N+ Sbjct: 716 RAFLHFQNKRVIKAAYNFKDQYICFLIDPKAGVVTVLDPLDYSHTMYRHFLQILQYAYNY 775 >09_02_0315 - 7179332-7179949 Length = 205 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 Query: 136 KLTILLNGRQ*LGSAPRIADVYGLR*PLTIRWAVCSSAYKGN 11 +L+++ GR G A R+A+V P + W +CS Y+GN Sbjct: 73 ELSVVPRGRVPRGGA-RVAEVLIEPGPERVAWVLCSWGYEGN 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,149,550 Number of Sequences: 37544 Number of extensions: 294794 Number of successful extensions: 422 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -