BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1228 (507 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0010 - 18356835-18357080,18357475-18357672,18357780-183580... 28 3.7 04_04_0289 + 24167246-24167411,24167584-24167708,24167744-241686... 27 8.7 >11_05_0010 - 18356835-18357080,18357475-18357672,18357780-18358046, 18358870-18359067,18359151-18359417,18359524-18359724, 18359807-18361363,18361499-18361859,18362602-18363467 Length = 1386 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 344 PVDMS*RRQKLESICISVSIFLNLITISYIS 436 P D+ +LESI IS +I +N + SYIS Sbjct: 1255 PFDIKVTPHQLESITISSNIVINSLAFSYIS 1285 >04_04_0289 + 24167246-24167411,24167584-24167708,24167744-24168694, 24168788-24168940,24169251-24169475,24170102-24170587 Length = 701 Score = 27.1 bits (57), Expect = 8.7 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -1 Query: 483 LKVLVGIWQKTQRRYPDIYEIVMRFKNIE 397 LK+++ +W + RRYP ++ R + +E Sbjct: 351 LKLMMSVWSWSPRRYPFVFGHAPRLQRLE 379 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,798,180 Number of Sequences: 37544 Number of extensions: 179474 Number of successful extensions: 342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -