BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1226 (508 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 3.6 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 4.8 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 6.3 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 6.3 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 6.3 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 356 LQFADRNKHDGQRYVFIWP 300 + F+DR K G R IWP Sbjct: 554 VSFSDRLKSRGIRTAAIWP 572 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 388 HA*FQHRERRGPHWW 432 H FQH P+WW Sbjct: 82 HKVFQHLMIHRPNWW 96 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = -1 Query: 175 YVNDVIVLTRFTSRILRVKHNQKMMSFVFQN*I*EMMSLVFQN*T 41 Y+N+V++ +++ N K+MS F++ +M+L+ + T Sbjct: 112 YLNNVLLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEIT 156 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = -1 Query: 175 YVNDVIVLTRFTSRILRVKHNQKMMSFVFQN*I*EMMSLVFQN*T 41 Y+N+V++ +++ N K+MS F++ +M+L+ + T Sbjct: 112 YLNNVLLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEIT 156 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = -1 Query: 175 YVNDVIVLTRFTSRILRVKHNQKMMSFVFQN*I*EMMSLVFQN*T 41 Y+N+V++ +++ N K+MS F++ +M+L+ + T Sbjct: 112 YLNNVLLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEIT 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,180 Number of Sequences: 336 Number of extensions: 2698 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -