BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1226 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 3.2 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 7.3 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 7.3 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 9.7 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 126 RRILLVKRVKTMTSFTYGNYSASQTAARIAGC 221 + ++LVK+VK + YG+ S T C Sbjct: 11 QNVVLVKKVKIVLLIFYGSIMFSMTQVNKEEC 42 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.0 bits (42), Expect = 7.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 89 SKLNLRNDVTCFSKLNWLYE*NST 18 + +NL + C S L+W NST Sbjct: 287 ASVNLICHILCMSDLHWQLPHNST 310 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 7.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 317 YVFIWPS*YYRKKFGRAHGQRDLGLT 240 +V IW + F R +GQ +GLT Sbjct: 59 HVMIWIGFGFLMTFLRRYGQSAVGLT 84 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -1 Query: 292 IIGRSLVVHTDKEIWALPII 233 I+ ++++ HT K +W P I Sbjct: 121 IMTKAILHHTGKVVWKPPAI 140 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,110 Number of Sequences: 438 Number of extensions: 3047 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -