BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1224 (349 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 62 2e-10 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 61 2e-10 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 61 2e-10 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 61 3e-10 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 61 3e-10 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 58 2e-09 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 58 2e-09 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 58 3e-09 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 48 3e-06 12_02_1282 + 27528159-27529148,27529549-27529614 46 6e-06 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 36 0.007 04_03_0926 - 20861383-20862198,20862359-20862430,20862938-208631... 30 0.57 07_03_0463 - 18449908-18450171,18450718-18450810,18451170-184512... 29 0.76 09_03_0046 + 11862923-11863112,11863225-11863406,11863522-118636... 28 1.8 07_03_0288 + 16285485-16285721,16285811-16286184,16286499-162868... 28 2.3 09_04_0747 + 19892090-19893304,19893471-19893602,19894168-198942... 26 7.1 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 26 7.1 07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-50... 26 7.1 01_06_1153 - 34942608-34942975,34943082-34943330,34943516-349436... 26 7.1 08_02_1455 + 27230134-27231110,27231195-27231327,27231417-272315... 26 9.3 07_03_1740 - 29153551-29153964 26 9.3 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 61.7 bits (143), Expect = 2e-10 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDESGPSIVHRKC Sbjct: 346 ASLSTFQQMWISKGEYDESGPSIVHRKC 373 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 61.3 bits (142), Expect = 2e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDESGP+IVHRKC Sbjct: 349 ASLSTFQQMWISKDEYDESGPAIVHRKC 376 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 61.3 bits (142), Expect = 2e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDESGP+IVHRKC Sbjct: 349 ASLSTFQQMWISKDEYDESGPAIVHRKC 376 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 60.9 bits (141), Expect = 3e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDESGP+IVHRKC Sbjct: 352 ASLSTFQQMWISKAEYDESGPAIVHRKC 379 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 60.9 bits (141), Expect = 3e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+K EYDESGPSIVHRKC Sbjct: 349 ASLSTFQQMWIAKAEYDESGPSIVHRKC 376 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 58.0 bits (134), Expect = 2e-09 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWIS+ EY+ESGP+IVHRKC Sbjct: 349 ASLSTFQQMWISRAEYEESGPAIVHRKC 376 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 58.0 bits (134), Expect = 2e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDESGP IVH KC Sbjct: 348 ASLSTFQQMWISKAEYDESGPGIVHMKC 375 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 57.6 bits (133), Expect = 3e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDESGP IVH KC Sbjct: 348 ASLSTFQQMWISKGEYDESGPGIVHMKC 375 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 47.6 bits (108), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 317 QMWISKQEYDESGPSIVHRKC 255 QMWISK EYDESGP+IVHRKC Sbjct: 370 QMWISKGEYDESGPAIVHRKC 390 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 46.4 bits (105), Expect = 6e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 317 QMWISKQEYDESGPSIVHRKC 255 +MWI+K EYDESGPSIVHRKC Sbjct: 330 KMWIAKAEYDESGPSIVHRKC 350 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 36.3 bits (80), Expect = 0.007 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 320 QQMWISKQEYDESGPSIVHRKC 255 Q ++K +YDE+GPSIVH+KC Sbjct: 376 QNQHVTKGDYDETGPSIVHKKC 397 >04_03_0926 - 20861383-20862198,20862359-20862430,20862938-20863123, 20863214-20863304,20863698-20863852,20864501-20864579, 20866797-20867263 Length = 621 Score = 29.9 bits (64), Expect = 0.57 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -1 Query: 310 GSRNRSTTSLAPPLYTGSALNAPRVSCLQQ--PAAGCS 203 GS++ S SLAPP+ T +AP V C++ P A CS Sbjct: 577 GSKDDSVLSLAPPVQTSQ--HAPLVDCIRTRWPRAVCS 612 >07_03_0463 - 18449908-18450171,18450718-18450810,18451170-18451254, 18451607-18451705,18452099-18452238,18453036-18453482 Length = 375 Score = 29.5 bits (63), Expect = 0.76 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 150 ITIISYVQLN*RRLQA*IEHPAAGCWRQLTRGAFRA 257 +T + +V L RLQ +E PAA CWR L GA R+ Sbjct: 245 LTFVPFVVL---RLQKFLESPAATCWRALV-GAVRS 276 >09_03_0046 + 11862923-11863112,11863225-11863406,11863522-11863634, 11863894-11864140,11864333-11864452,11864601-11864604, 11864800-11864846,11864992-11865068,11865381-11865431, 11865519-11865567,11865694-11865718,11866226-11866344 Length = 407 Score = 28.3 bits (60), Expect = 1.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 271 LYTGSALNAPRVSCLQQPAAGCSI 200 L TG++ PRVSCL P+ C++ Sbjct: 102 LGTGTSEGIPRVSCLTNPSKTCTV 125 >07_03_0288 + 16285485-16285721,16285811-16286184,16286499-16286892, 16286917-16287806,16291189-16291446,16291518-16291628, 16291697-16291775,16291880-16291972,16292095-16292280 Length = 873 Score = 27.9 bits (59), Expect = 2.3 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -1 Query: 349 SDPQPPSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAA 212 SDP P K GS N + PP LNAPR S + AA Sbjct: 51 SDPHPSPAKKRKGGSDNEVDSDYVPP---EPVLNAPRRSKRKDQAA 93 >09_04_0747 + 19892090-19893304,19893471-19893602,19894168-19894215, 19894697-19894766,19894936-19894963,19896021-19896519 Length = 663 Score = 26.2 bits (55), Expect = 7.1 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 217 RAAGGS*RAVRLEHFLCTMEGPDSSYSCFEIHICWKVEREAE 342 + AG RA R+ + E SYS H CW E+EAE Sbjct: 533 KRAGADVRAKRMT--VSAAEATGCSYSQRRRHCCWWHEQEAE 572 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 26.2 bits (55), Expect = 7.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 338 ASLSTFQQMWISKQE 294 ASL +FQQMW SK + Sbjct: 455 ASLGSFQQMWFSKAD 469 >07_01_0069 + 505291-505327,505726-505956,506317-506652,507025-507372, 507735-508594,508902-508971,509157-509371,509477-509537, 509606-509715,510644-510694,510794-510916 Length = 813 Score = 26.2 bits (55), Expect = 7.1 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQ 197 P N C S +TTS AP AL A +V + PAA S++ Sbjct: 52 PDESGNGCTSGEGATTSTAP------ALEAEKVDKREAPAASASVE 91 >01_06_1153 - 34942608-34942975,34943082-34943330,34943516-34943625, 34944698-34944771,34945237-34945306,34945848-34945947, 34946045-34946120,34946572-34946646,34947067-34947156, 34947238-34947354,34947457-34947567,34947649-34947788, 34947962-34948043,34948224-34948303,34948938-34949046, 34949295-34949417,34949972-34950044,34950338-34950489, 34951029-34951127,34952258-34952383 Length = 807 Score = 26.2 bits (55), Expect = 7.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 337 PPSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRV 236 PPSL SN ++ R P+ S LN P+V Sbjct: 664 PPSLLSNIQAAQKRPVAQPKQPVSNSSRLNQPKV 697 >08_02_1455 + 27230134-27231110,27231195-27231327,27231417-27231501, 27233372-27233571 Length = 464 Score = 25.8 bits (54), Expect = 9.3 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Frame = -1 Query: 349 SDPQPPSLPSNKCGSRNRST------TSLAPPL 269 SDP PP LP K G R + + L+PPL Sbjct: 122 SDPPPPGLPPRKGGHRRSQSDIPFGFSHLSPPL 154 >07_03_1740 - 29153551-29153964 Length = 137 Score = 25.8 bits (54), Expect = 9.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 343 PQPPSLPSNKCGSRNRSTTSLAPPL 269 P PP P C S S T+ APP+ Sbjct: 84 PPPPPPPPAYCASYAASATAAAPPV 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,070,291 Number of Sequences: 37544 Number of extensions: 155209 Number of successful extensions: 481 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -