BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1224 (349 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X63432-1|CAA45026.1| 375|Homo sapiens mutant beta-actin (beta'... 64 9e-11 X04098-1|CAA27723.1| 375|Homo sapiens gamma-actin protein. 64 9e-11 X00351-1|CAA25099.1| 375|Homo sapiens protein ( Human mRNA for ... 64 9e-11 V00478-1|CAA23745.1| 124|Homo sapiens protein ( Human mRNA frag... 64 9e-11 M19283-1|AAA51579.1| 375|Homo sapiens ACTG1 protein. 64 9e-11 M16247-1|AAA51580.1| 232|Homo sapiens ACTG1 protein. 64 9e-11 M10277-1|AAA51567.1| 375|Homo sapiens protein ( Human cytoplasm... 64 9e-11 EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot... 64 9e-11 DQ471327-1|ABF01018.1| 375|Homo sapiens PS1TP5-binding protein ... 64 9e-11 BT019856-1|AAV38659.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC053572-1|AAH53572.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC023548-1|AAH23548.1| 263|Homo sapiens ACTG1 protein protein. 64 9e-11 BC018774-1|AAH18774.1| 375|Homo sapiens ACTG1 protein protein. 64 9e-11 BC017450-1|AAH17450.1| 363|Homo sapiens Unknown (protein for IM... 64 9e-11 BC016045-1|AAH16045.1| 375|Homo sapiens actin, beta protein. 64 9e-11 BC015779-1|AAH15779.1| 375|Homo sapiens ACTG1 protein protein. 64 9e-11 BC015695-1|AAH15695.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC015005-1|AAH15005.1| 375|Homo sapiens ACTG1 protein protein. 64 9e-11 BC014861-1|AAH14861.1| 375|Homo sapiens actin, beta protein. 64 9e-11 BC013380-1|AAH13380.1| 375|Homo sapiens actin, beta protein. 64 9e-11 BC012854-1|AAH12854.1| 360|Homo sapiens ACTB protein protein. 64 9e-11 BC012050-1|AAH12050.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC010999-1|AAH10999.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC010417-1|AAH10417.2| 165|Homo sapiens ACTG1 protein protein. 64 9e-11 BC009848-1|AAH09848.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC009544-1|AAH09544.1| 159|Homo sapiens Unknown (protein for IM... 64 9e-11 BC008633-1|AAH08633.1| 368|Homo sapiens actin, beta protein. 64 9e-11 BC007442-1|AAH07442.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 BC004251-1|AAH04251.1| 375|Homo sapiens actin, beta protein. 64 9e-11 BC002409-1|AAH02409.1| 375|Homo sapiens actin, beta protein. 64 9e-11 BC001920-1|AAH01920.1| 375|Homo sapiens ACTG1 protein protein. 64 9e-11 BC001301-1|AAH01301.1| 375|Homo sapiens actin, beta protein. 64 9e-11 BC000292-1|AAH00292.1| 375|Homo sapiens actin, gamma 1 protein. 64 9e-11 AY582799-1|AAS79319.1| 375|Homo sapiens actin, beta protein. 64 9e-11 AK223055-1|BAD96775.1| 375|Homo sapiens beta actin variant prot... 64 9e-11 AK223032-1|BAD96752.1| 375|Homo sapiens beta actin variant prot... 64 9e-11 AK222925-1|BAD96645.1| 375|Homo sapiens beta actin variant prot... 64 9e-11 AC006483-1|AAP22343.1| 375|Homo sapiens unknown protein. 64 9e-11 X13839-1|CAA32064.1| 377|Homo sapiens protein ( Human mRNA for ... 63 2e-10 M33216-1|AAA60560.1| 47|Homo sapiens smooth muscle alpha-actin... 63 2e-10 J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. 63 2e-10 J00073-1|AAB59619.1| 377|Homo sapiens alpha-cardiac actin protein. 63 2e-10 CR541795-1|CAG46594.1| 377|Homo sapiens ACTC protein. 63 2e-10 CR536518-1|CAG38756.1| 377|Homo sapiens ACTA2 protein. 63 2e-10 BC093052-1|AAH93052.1| 377|Homo sapiens actin, alpha 2, smooth ... 63 2e-10 BC017554-1|AAH17554.1| 377|Homo sapiens actin, alpha 2, smooth ... 63 2e-10 BC009978-1|AAH09978.1| 377|Homo sapiens actin, alpha, cardiac m... 63 2e-10 AY692464-1|AAW29811.1| 377|Homo sapiens growth-inhibiting gene ... 63 2e-10 AL157394-6|CAI13864.1| 377|Homo sapiens actin, alpha 2, smooth ... 63 2e-10 M20543-1|AAA60296.1| 377|Homo sapiens ACTA1 protein. 62 5e-10 J00068-1|AAB59376.1| 377|Homo sapiens ACTA1 protein. 62 5e-10 CR541796-1|CAG46595.1| 377|Homo sapiens ACTA1 protein. 62 5e-10 CR536516-1|CAG38754.1| 377|Homo sapiens ACTA1 protein. 62 5e-10 BC012597-1|AAH12597.1| 377|Homo sapiens actin, alpha 1, skeleta... 62 5e-10 AY280960-1|AAP37280.1| 254|Homo sapiens actin alpha 1 skeletal ... 62 5e-10 AL160004-6|CAI19050.1| 377|Homo sapiens actin, alpha 1, skeleta... 62 5e-10 AL160004-5|CAI19052.1| 342|Homo sapiens actin, alpha 1, skeleta... 62 5e-10 AL160004-4|CAI19051.1| 287|Homo sapiens actin, alpha 1, skeleta... 62 5e-10 AF182035-1|AAF02694.1| 377|Homo sapiens skeletal muscle alpha-a... 62 5e-10 X16940-1|CAA34814.1| 376|Homo sapiens protein ( Human mRNA for ... 61 1e-09 D00654-1|BAA00546.1| 376|Homo sapiens enteric smooth muscle gam... 61 1e-09 CR541794-1|CAG46593.1| 376|Homo sapiens ACTG2 protein. 61 1e-09 CR536515-1|CAG38753.1| 376|Homo sapiens ACTG2 protein. 61 1e-09 BC094877-1|AAH94877.1| 376|Homo sapiens ACTG2 protein protein. 61 1e-09 BC012617-1|AAH12617.1| 376|Homo sapiens actin, gamma 2, smooth ... 61 1e-09 AC073046-2|AAX88909.1| 376|Homo sapiens unknown protein. 61 1e-09 BC092424-1|AAH92424.1| 219|Homo sapiens Unknown (protein for MG... 60 2e-09 CR533529-1|CAG38560.1| 429|Homo sapiens BAF53A protein. 50 3e-06 BC036371-1|AAH36371.1| 429|Homo sapiens actin-like 6A protein. 50 3e-06 BC020944-1|AAH20944.1| 426|Homo sapiens actin-like 6B protein. 50 3e-06 BC001391-1|AAH01391.1| 429|Homo sapiens actin-like 6A protein. 50 3e-06 BC000949-1|AAH00949.1| 387|Homo sapiens actin-like 6A protein. 50 3e-06 AK223212-1|BAD96932.1| 429|Homo sapiens actin-like 6A isoform 1... 50 3e-06 AF041475-1|AAD54678.1| 426|Homo sapiens BAF53b protein. 50 3e-06 AF041474-1|AAC94991.1| 429|Homo sapiens BAF53a protein. 50 3e-06 AC099394-1|AAP21874.1| 426|Homo sapiens unknown protein. 50 3e-06 AB061315-1|BAB87848.1| 387|Homo sapiens hArpNbeta-s protein. 50 3e-06 AB060168-1|BAB87844.1| 387|Homo sapiens hArpNbeta-s protein. 50 3e-06 AB015907-1|BAA74577.1| 429|Homo sapiens actin-related protein h... 50 3e-06 AB015906-1|BAA74576.1| 426|Homo sapiens actin-related protein h... 50 3e-06 BC007289-1|AAH07289.1| 372|Homo sapiens actin related protein M... 44 2e-04 AK055346-1|BAB70906.1| 372|Homo sapiens protein ( Homo sapiens ... 44 2e-04 AB049117-1|BAB39481.1| 372|Homo sapiens actin related protein p... 44 2e-04 X82207-1|CAA57691.1| 376|Homo sapiens beta-centracetin protein. 43 2e-04 BC010090-1|AAH10090.1| 376|Homo sapiens ARP1 actin-related prot... 43 2e-04 BC006372-1|AAH06372.1| 376|Homo sapiens ARP1 actin-related prot... 43 2e-04 BC004374-1|AAH04374.1| 376|Homo sapiens ARP1 actin-related prot... 43 2e-04 AC017099-2|AAY24280.1| 376|Homo sapiens unknown protein. 43 2e-04 Z14978-1|CAA78701.1| 376|Homo sapiens actin-related protein pro... 43 3e-04 X82206-1|CAA57690.1| 376|Homo sapiens alpha-centractin protein. 43 3e-04 BC026016-1|AAH26016.1| 376|Homo sapiens ARP1 actin-related prot... 43 3e-04 BC000693-1|AAH00693.1| 376|Homo sapiens ARP1 actin-related prot... 43 3e-04 AL121928-12|CAC08404.1| 376|Homo sapiens ARP1 actin-related pro... 43 3e-04 BC045752-1|AAH45752.1| 416|Homo sapiens hypothetical protein MG... 42 7e-04 BC024028-1|AAH24028.1| 416|Homo sapiens hypothetical protein MG... 42 7e-04 BC033789-1|AAH33789.1| 415|Homo sapiens actin-like 7B protein. 40 0.002 AL359692-3|CAI40570.1| 415|Homo sapiens actin-like 7B protein. 40 0.002 AF113527-1|AAD44110.1| 415|Homo sapiens actin-like-7-beta protein. 40 0.002 AB284521-1|BAF41972.1| 415|Homo sapiens t-actin 1 protein. 40 0.002 BC029499-1|AAH29499.1| 376|Homo sapiens actin-related protein T... 37 0.015 BC014610-1|AAH14610.1| 435|Homo sapiens actin-like 7A protein. 37 0.015 AL359692-4|CAI40571.1| 435|Homo sapiens actin-like 7A protein. 37 0.015 AL356984-1|CAH72587.1| 377|Homo sapiens actin-related protein M... 37 0.015 AF440740-1|AAM00433.1| 377|Homo sapiens actin-related protein T... 37 0.015 AF113526-1|AAD44109.1| 435|Homo sapiens actin-like-7-alpha prot... 37 0.015 AB284520-1|BAF41971.1| 435|Homo sapiens human t-actin 2 protein. 37 0.015 AB057364-1|BAB85862.1| 377|Homo sapiens actin-related protein h... 37 0.015 Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 ... 37 0.020 BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T... 37 0.020 AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T... 37 0.020 DQ407611-1|ABD66582.1| 151|Homo sapiens beta-actin protein. 33 0.33 AC006276-2|AAC99795.1| 210|Homo sapiens R28379_3 protein. 31 1.3 U95299-1|AAC32288.1| 2003|Homo sapiens Notch4 protein. 29 3.0 U89335-1|AAC63097.1| 1999|Homo sapiens notch4 protein. 29 3.0 D86566-1|BAA13116.1| 955|Homo sapiens notch related protein pro... 29 3.0 BX284927-1|CAM25850.1| 2003|Homo sapiens Notch homolog 4 (Drosop... 29 3.0 BX284686-1|CAM26209.1| 2003|Homo sapiens Notch homolog 4 (Drosop... 29 3.0 BC063815-1|AAH63815.1| 647|Homo sapiens NOTCH4 protein protein. 29 3.0 AL845509-1|CAI18564.1| 2003|Homo sapiens Notch homolog 4 (Drosop... 29 3.0 AL845464-12|CAI41803.1| 2003|Homo sapiens Notch homolog 4 (Droso... 29 3.0 AL662884-27|CAI18362.1| 2003|Homo sapiens Notch homolog 4 (Droso... 29 3.0 AL662830-9|CAI17543.1| 2005|Homo sapiens Notch homolog 4 (Drosop... 29 3.0 AB023961-1|BAB20317.1| 502|Homo sapiens notch4 protein. 29 3.0 BC101596-1|AAI01597.1| 123|Homo sapiens transmembrane protein 8... 28 7.0 BC101594-1|AAI01595.1| 123|Homo sapiens transmembrane protein 8... 28 7.0 AL389875-2|CAO03392.1| 1794|Homo sapiens fer-1-like 4 (C. elegan... 28 7.0 AL121586-1|CAB89410.2| 1794|Homo sapiens fer-1-like 4 (C. elegan... 28 7.0 AL109827-5|CAI20117.2| 1794|Homo sapiens fer-1-like 4 (C. elegan... 28 7.0 AK091087-1|BAC03580.1| 123|Homo sapiens protein ( Homo sapiens ... 28 7.0 >X63432-1|CAA45026.1| 375|Homo sapiens mutant beta-actin (beta'-actin) protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >X04098-1|CAA27723.1| 375|Homo sapiens gamma-actin protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >X00351-1|CAA25099.1| 375|Homo sapiens protein ( Human mRNA for beta-actin. ). Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >V00478-1|CAA23745.1| 124|Homo sapiens protein ( Human mRNA fragment encoding cytoplasmic actin. (isolated from cultured epidermal cells grown from human foreskin). ). Length = 124 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 96 ASLSTFQQMWISKQEYDESGPSIVHRKC 123 >M19283-1|AAA51579.1| 375|Homo sapiens ACTG1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >M16247-1|AAA51580.1| 232|Homo sapiens ACTG1 protein. Length = 232 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 204 ASLSTFQQMWISKQEYDESGPSIVHRKC 231 >M10277-1|AAA51567.1| 375|Homo sapiens protein ( Human cytoplasmic beta-actin gene, complete cds. ). Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein. Length = 1075 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 1047 ASLSTFQQMWISKQEYDESGPSIVHRKC 1074 >DQ471327-1|ABF01018.1| 375|Homo sapiens PS1TP5-binding protein 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BT019856-1|AAV38659.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC053572-1|AAH53572.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC023548-1|AAH23548.1| 263|Homo sapiens ACTG1 protein protein. Length = 263 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 235 ASLSTFQQMWISKQEYDESGPSIVHRKC 262 >BC018774-1|AAH18774.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC017450-1|AAH17450.1| 363|Homo sapiens Unknown (protein for IMAGE:3538275) protein. Length = 363 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 335 ASLSTFQQMWISKQEYDESGPSIVHRKC 362 >BC016045-1|AAH16045.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC015779-1|AAH15779.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC015695-1|AAH15695.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC015005-1|AAH15005.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC014861-1|AAH14861.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC013380-1|AAH13380.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC012854-1|AAH12854.1| 360|Homo sapiens ACTB protein protein. Length = 360 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 332 ASLSTFQQMWISKQEYDESGPSIVHRKC 359 >BC012050-1|AAH12050.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC010999-1|AAH10999.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC010417-1|AAH10417.2| 165|Homo sapiens ACTG1 protein protein. Length = 165 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 137 ASLSTFQQMWISKQEYDESGPSIVHRKC 164 >BC009848-1|AAH09848.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC009544-1|AAH09544.1| 159|Homo sapiens Unknown (protein for IMAGE:3897065) protein. Length = 159 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 131 ASLSTFQQMWISKQEYDESGPSIVHRKC 158 >BC008633-1|AAH08633.1| 368|Homo sapiens actin, beta protein. Length = 368 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 340 ASLSTFQQMWISKQEYDESGPSIVHRKC 367 >BC007442-1|AAH07442.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC004251-1|AAH04251.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC002409-1|AAH02409.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC001920-1|AAH01920.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC001301-1|AAH01301.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >BC000292-1|AAH00292.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >AY582799-1|AAS79319.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >AK223055-1|BAD96775.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >AK223032-1|BAD96752.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >AK222925-1|BAD96645.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >AC006483-1|AAP22343.1| 375|Homo sapiens unknown protein. Length = 375 Score = 64.5 bits (150), Expect = 9e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 347 ASLSTFQQMWISKQEYDESGPSIVHRKC 374 >X13839-1|CAA32064.1| 377|Homo sapiens protein ( Human mRNA for vascular smooth muscle alpha-actin. ). Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >M33216-1|AAA60560.1| 47|Homo sapiens smooth muscle alpha-actin protein. Length = 47 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 19 ASLSTFQQMWISKQEYDEAGPSIVHRKC 46 >J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >J00073-1|AAB59619.1| 377|Homo sapiens alpha-cardiac actin protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >CR541795-1|CAG46594.1| 377|Homo sapiens ACTC protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >CR536518-1|CAG38756.1| 377|Homo sapiens ACTA2 protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >BC093052-1|AAH93052.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >BC017554-1|AAH17554.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >BC009978-1|AAH09978.1| 377|Homo sapiens actin, alpha, cardiac muscle 1 protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >AY692464-1|AAW29811.1| 377|Homo sapiens growth-inhibiting gene 46 protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >AL157394-6|CAI13864.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWISKQEYDEAGPSIVHRKC 376 >M20543-1|AAA60296.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >J00068-1|AAB59376.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >CR541796-1|CAG46595.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >CR536516-1|CAG38754.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >BC012597-1|AAH12597.1| 377|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >AY280960-1|AAP37280.1| 254|Homo sapiens actin alpha 1 skeletal muscle protein protein. Length = 254 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 226 ASLSTFQQMWITKQEYDEAGPSIVHRKC 253 >AL160004-6|CAI19050.1| 377|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >AL160004-5|CAI19052.1| 342|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 342 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 314 ASLSTFQQMWITKQEYDEAGPSIVHRKC 341 >AL160004-4|CAI19051.1| 287|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 287 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 259 ASLSTFQQMWITKQEYDEAGPSIVHRKC 286 >AF182035-1|AAF02694.1| 377|Homo sapiens skeletal muscle alpha-actin precursor protein. Length = 377 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWI+KQEYDE+GPSIVHRKC Sbjct: 349 ASLSTFQQMWITKQEYDEAGPSIVHRKC 376 >X16940-1|CAA34814.1| 376|Homo sapiens protein ( Human mRNA for enteric smooth muscle gamma-actin. ). Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >D00654-1|BAA00546.1| 376|Homo sapiens enteric smooth muscle gamma-actin protein. Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >CR541794-1|CAG46593.1| 376|Homo sapiens ACTG2 protein. Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >CR536515-1|CAG38753.1| 376|Homo sapiens ACTG2 protein. Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >BC094877-1|AAH94877.1| 376|Homo sapiens ACTG2 protein protein. Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >BC012617-1|AAH12617.1| 376|Homo sapiens actin, gamma 2, smooth muscle, enteric protein. Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >AC073046-2|AAX88909.1| 376|Homo sapiens unknown protein. Length = 376 Score = 60.9 bits (141), Expect = 1e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISK EYDE+GPSIVHRKC Sbjct: 348 ASLSTFQQMWISKPEYDEAGPSIVHRKC 375 >BC092424-1|AAH92424.1| 219|Homo sapiens Unknown (protein for MGC:102982) protein. Length = 219 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLSTFQQMWISKQEY ES PSIVHRKC Sbjct: 191 ASLSTFQQMWISKQEYSESSPSIVHRKC 218 >CR533529-1|CAG38560.1| 429|Homo sapiens BAF53A protein. Length = 429 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 401 ASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC036371-1|AAH36371.1| 429|Homo sapiens actin-like 6A protein. Length = 429 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 401 ASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC020944-1|AAH20944.1| 426|Homo sapiens actin-like 6B protein. Length = 426 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 398 ASLGTFQQMWISKQEYEEGGKQCVERKC 425 >BC001391-1|AAH01391.1| 429|Homo sapiens actin-like 6A protein. Length = 429 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 401 ASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC000949-1|AAH00949.1| 387|Homo sapiens actin-like 6A protein. Length = 387 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 359 ASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AK223212-1|BAD96932.1| 429|Homo sapiens actin-like 6A isoform 1 variant protein. Length = 429 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 401 ASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AF041475-1|AAD54678.1| 426|Homo sapiens BAF53b protein. Length = 426 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 398 ASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AF041474-1|AAC94991.1| 429|Homo sapiens BAF53a protein. Length = 429 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 401 ASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AC099394-1|AAP21874.1| 426|Homo sapiens unknown protein. Length = 426 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 398 ASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AB061315-1|BAB87848.1| 387|Homo sapiens hArpNbeta-s protein. Length = 387 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 359 ASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AB060168-1|BAB87844.1| 387|Homo sapiens hArpNbeta-s protein. Length = 387 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 359 ASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AB015907-1|BAA74577.1| 429|Homo sapiens actin-related protein hArpN beta protein. Length = 429 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 401 ASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AB015906-1|BAA74576.1| 426|Homo sapiens actin-related protein hArpN alpha protein. Length = 426 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL TFQQMWISKQEY+E G V RKC Sbjct: 398 ASLGTFQQMWISKQEYEEGGKQCVERKC 425 >BC007289-1|AAH07289.1| 372|Homo sapiens actin related protein M1 protein. Length = 372 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLS FQ MWI+ E+ E GP+IVH++C Sbjct: 344 ASLSAFQDMWITAAEFKEVGPNIVHQRC 371 >AK055346-1|BAB70906.1| 372|Homo sapiens protein ( Homo sapiens cDNA FLJ30784 fis, clone FEBRA2000881, moderately similar to ACTIN 6. ). Length = 372 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLS FQ MWI+ E+ E GP+IVH++C Sbjct: 344 ASLSAFQDMWITAAEFKEVGPNIVHQRC 371 >AB049117-1|BAB39481.1| 372|Homo sapiens actin related protein protein. Length = 372 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASLS FQ MWI+ E+ E GP+IVH++C Sbjct: 344 ASLSAFQDMWITAAEFKEVGPNIVHQRC 371 >X82207-1|CAA57691.1| 376|Homo sapiens beta-centracetin protein. Length = 376 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGSRAIHRK 374 >BC010090-1|AAH10090.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGSRAIHRK 374 >BC006372-1|AAH06372.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGSRAIHRK 374 >BC004374-1|AAH04374.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGSRAIHRK 374 >AC017099-2|AAY24280.1| 376|Homo sapiens unknown protein. Length = 376 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGSRAIHRK 374 >Z14978-1|CAA78701.1| 376|Homo sapiens actin-related protein protein. Length = 376 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGARSIHRK 374 >X82206-1|CAA57690.1| 376|Homo sapiens alpha-centractin protein. Length = 376 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGARSIHRK 374 >BC026016-1|AAH26016.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGARSIHRK 374 >BC000693-1|AAH00693.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGARSIHRK 374 >AL121928-12|CAC08404.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRK 258 ASL TF++MW+SK+EY+E G +HRK Sbjct: 348 ASLDTFKKMWVSKKEYEEDGARSIHRK 374 >BC045752-1|AAH45752.1| 416|Homo sapiens hypothetical protein MGC33407 protein. Length = 416 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQ W+ +++Y+E GP IV+RKC Sbjct: 388 ASLRAFQSCWVLREQYEEQGPYIVYRKC 415 >BC024028-1|AAH24028.1| 416|Homo sapiens hypothetical protein MGC33407 protein. Length = 416 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQ W+ +++Y+E GP IV+RKC Sbjct: 388 ASLRAFQSCWVLREQYEEQGPYIVYRKC 415 >BC033789-1|AAH33789.1| 415|Homo sapiens actin-like 7B protein. Length = 415 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQQ+W+SK+E++E G ++ KC Sbjct: 388 ASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AL359692-3|CAI40570.1| 415|Homo sapiens actin-like 7B protein. Length = 415 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQQ+W+SK+E++E G ++ KC Sbjct: 388 ASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AF113527-1|AAD44110.1| 415|Homo sapiens actin-like-7-beta protein. Length = 415 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQQ+W+SK+E++E G ++ KC Sbjct: 388 ASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AB284521-1|BAF41972.1| 415|Homo sapiens t-actin 1 protein. Length = 415 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQQ+W+SK+E++E G ++ KC Sbjct: 388 ASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >BC029499-1|AAH29499.1| 376|Homo sapiens actin-related protein T2 protein. Length = 376 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 SLS+F+QMW++ ++ E G S+V R+C Sbjct: 349 SLSSFKQMWVTAADFKEFGTSVVQRRC 375 >BC014610-1|AAH14610.1| 435|Homo sapiens actin-like 7A protein. Length = 435 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQ +W+ + EY+E GP ++R+C Sbjct: 407 ASLQGFQPLWVHRFEYEEHGPFFLYRRC 434 >AL359692-4|CAI40571.1| 435|Homo sapiens actin-like 7A protein. Length = 435 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQ +W+ + EY+E GP ++R+C Sbjct: 407 ASLQGFQPLWVHRFEYEEHGPFFLYRRC 434 >AL356984-1|CAH72587.1| 377|Homo sapiens actin-related protein M2 (ARPM2) protein. Length = 377 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 SLS+F+QMW++ ++ E G S+V R+C Sbjct: 350 SLSSFKQMWVTAADFKEFGTSVVQRRC 376 >AF440740-1|AAM00433.1| 377|Homo sapiens actin-related protein T2 protein. Length = 377 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 SLS+F+QMW++ ++ E G S+V R+C Sbjct: 350 SLSSFKQMWVTAADFKEFGTSVVQRRC 376 >AF113526-1|AAD44109.1| 435|Homo sapiens actin-like-7-alpha protein. Length = 435 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQ +W+ + EY+E GP ++R+C Sbjct: 407 ASLQGFQPLWVHRFEYEEHGPFFLYRRC 434 >AB284520-1|BAF41971.1| 435|Homo sapiens human t-actin 2 protein. Length = 435 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 338 ASLSTFQQMWISKQEYDESGPSIVHRKC 255 ASL FQ +W+ + EY+E GP ++R+C Sbjct: 407 ASLQGFQPLWVHRFEYEEHGPFFLYRRC 434 >AB057364-1|BAB85862.1| 377|Homo sapiens actin-related protein hArpM2 protein. Length = 377 Score = 37.1 bits (82), Expect = 0.015 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 SLS+F+QMW++ ++ E G S+V R+C Sbjct: 350 SLSSFKQMWVTAADFKEFGTSVVQRRC 376 >Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 (ACTRT1) protein. Length = 376 Score = 36.7 bits (81), Expect = 0.020 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 S+S+F+QMW++ ++ E G S+V R+C Sbjct: 349 SMSSFKQMWVTSADFKEYGTSVVQRRC 375 >BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 36.7 bits (81), Expect = 0.020 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 S+S+F+QMW++ ++ E G S+V R+C Sbjct: 349 SMSSFKQMWVTSADFKEYGTSVVQRRC 375 >AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 36.7 bits (81), Expect = 0.020 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = -3 Query: 335 SLSTFQQMWISKQEYDESGPSIVHRKC 255 S+S+F+QMW++ ++ E G S+V R+C Sbjct: 349 SMSSFKQMWVTSADFKEYGTSVVQRRC 375 >DQ407611-1|ABD66582.1| 151|Homo sapiens beta-actin protein. Length = 151 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -3 Query: 338 ASLSTFQQMWISKQ 297 ASLSTFQQMWISKQ Sbjct: 138 ASLSTFQQMWISKQ 151 >AC006276-2|AAC99795.1| 210|Homo sapiens R28379_3 protein. Length = 210 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = -1 Query: 340 QPPSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAG 209 QPP+ P CG P TG++ P V C Q P G Sbjct: 130 QPPAQPCQLCGRSPLGEAPPGTPPCTGTSCCMPGVRCRQSPHTG 173 >U95299-1|AAC32288.1| 2003|Homo sapiens Notch4 protein. Length = 2003 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >U89335-1|AAC63097.1| 1999|Homo sapiens notch4 protein. Length = 1999 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 444 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 498 >D86566-1|BAA13116.1| 955|Homo sapiens notch related protein protein. Length = 955 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >BX284927-1|CAM25850.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >BX284686-1|CAM26209.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >BC063815-1|AAH63815.1| 647|Homo sapiens NOTCH4 protein protein. Length = 647 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >AL845509-1|CAI18564.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >AL845464-12|CAI41803.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >AL662884-27|CAI18362.1| 2003|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2003 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 445 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 499 >AL662830-9|CAI17543.1| 2005|Homo sapiens Notch homolog 4 (Drosophila) protein. Length = 2005 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 447 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 501 >AB023961-1|BAB20317.1| 502|Homo sapiens notch4 protein. Length = 502 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 334 PSLPSNKCGSRNRSTTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNLR*FNC 170 P C + S L PP YTGS A CL QP S L F+C Sbjct: 444 PCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHC 498 >BC101596-1|AAI01597.1| 123|Homo sapiens transmembrane protein 84 protein. Length = 123 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 295 STTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNL 185 S + APPL S PR Q P CSI +CN+ Sbjct: 30 SASRCAPPLLEDSFSGCPRDFAAQHP---CSISSCNI 63 >BC101594-1|AAI01595.1| 123|Homo sapiens transmembrane protein 84 protein. Length = 123 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 295 STTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNL 185 S + APPL S PR Q P CSI +CN+ Sbjct: 30 SASRCAPPLLEDSFSGCPRDFAAQHP---CSISSCNI 63 >AL389875-2|CAO03392.1| 1794|Homo sapiens fer-1-like 4 (C. elegans) protein. Length = 1794 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 277 PPLYTGSALNAPRVSCLQQPAAGCSIQACNLR 182 PP++ G AL APRV ++ P +Q LR Sbjct: 845 PPVFLGRALAAPRVKLMEDPYQRPELQFFPLR 876 >AL121586-1|CAB89410.2| 1794|Homo sapiens fer-1-like 4 (C. elegans) protein. Length = 1794 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 277 PPLYTGSALNAPRVSCLQQPAAGCSIQACNLR 182 PP++ G AL APRV ++ P +Q LR Sbjct: 845 PPVFLGRALAAPRVKLMEDPYQRPELQFFPLR 876 >AL109827-5|CAI20117.2| 1794|Homo sapiens fer-1-like 4 (C. elegans) protein. Length = 1794 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 277 PPLYTGSALNAPRVSCLQQPAAGCSIQACNLR 182 PP++ G AL APRV ++ P +Q LR Sbjct: 845 PPVFLGRALAAPRVKLMEDPYQRPELQFFPLR 876 >AK091087-1|BAC03580.1| 123|Homo sapiens protein ( Homo sapiens cDNA FLJ33768 fis, clone BRHIP2000021. ). Length = 123 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 295 STTSLAPPLYTGSALNAPRVSCLQQPAAGCSIQACNL 185 S + APPL S PR Q P CSI +CN+ Sbjct: 30 SASRCAPPLLEDSFSGCPRDFAAQHP---CSISSCNI 63 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,362,553 Number of Sequences: 237096 Number of extensions: 775603 Number of successful extensions: 2320 Number of sequences better than 10.0: 129 Number of HSP's better than 10.0 without gapping: 2251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2317 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 2026198370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -