BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1223 (557 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 1.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.6 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 3.7 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 3.7 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 6.4 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 6.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.4 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.4 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 437 PQPQGQQREDDPYHVRNIQHARHVVAIQAV 526 P+PQ + + PYHV + + A V I V Sbjct: 251 PKPQTKTKPTSPYHVSDHKAAITVGVIMGV 280 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 390 LRVAPEEHPVLLTEAPLNPKANREKMTHI 476 LR+ P H V+ T +NP + EK+ HI Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL-HI 1488 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 219 KAPPSGRDGRYGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD 353 K P G G G+K E KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 219 KAPPSGRDGRYGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD 353 K P G G G+K E KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 63 IKRPAVTANREKQIPIAGR 7 IK P + ANR K IAG+ Sbjct: 284 IKLPKLAANRAKLEEIAGK 302 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 154 GMCKAGFAGD 183 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 288 SVPHLLHKSPSAHTDHHA 235 + PH H +P AH+ + A Sbjct: 438 ATPHHQHSTPLAHSSYPA 455 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 213 DRGEHGARSIISCETGLA 160 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 213 DRGEHGARSIISCETGLA 160 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,095 Number of Sequences: 438 Number of extensions: 4069 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -