BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1222 (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 25 2.3 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 24 3.1 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 3.1 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 24 3.1 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 3.1 AY341219-1|AAR13783.1| 200|Anopheles gambiae SRPN10 protein. 24 3.1 AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. 24 3.1 AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. 24 3.1 AY341215-1|AAR13779.1| 200|Anopheles gambiae SRPN10 protein. 24 3.1 AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. 24 3.1 AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. 24 3.1 AJ420785-2|CAD12782.1| 382|Anopheles gambiae serpin protein. 24 3.1 AJ420785-1|CAD12781.1| 379|Anopheles gambiae serpin protein. 24 3.1 AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine pr... 24 3.1 AJ271352-1|CAB69784.1| 379|Anopheles gambiae putative serine pr... 24 3.1 AY341218-1|AAR13782.1| 200|Anopheles gambiae SRPN10 protein. 24 4.1 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 4.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.4 EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. 23 7.2 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 7.2 U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 23 9.5 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 9.5 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 24.6 bits (51), Expect = 2.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 257 HEPPGSSRPPAMSTSNM 207 H PPG S PP +++ M Sbjct: 15 HRPPGLSNPPTCTSAKM 31 Score = 23.8 bits (49), Expect = 4.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 257 HEPPGSSRPPAMS 219 + PPGS RPP +S Sbjct: 9 NRPPGSHRPPGLS 21 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 247 GGSCRWTANRPRPTPASSPP 306 GGSC W PR T + P Sbjct: 84 GGSCIWAKKCPRRTQTTKKP 103 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.2 bits (50), Expect = 3.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 365 PTHQFHEYLFEISHGVHILIGGEDAGVGLG 276 PTHQ H + HG + GG G G G Sbjct: 278 PTHQTHHHHHHHQHGGGVGGGGGGGGGGGG 307 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.2 bits (50), Expect = 3.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 365 PTHQFHEYLFEISHGVHILIGGEDAGVGLG 276 PTHQ H + HG + GG G G G Sbjct: 278 PTHQTHHHHHHHQHGGGVGGGGGGGGGGGG 307 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 24.2 bits (50), Expect = 3.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 365 PTHQFHEYLFEISHGVHILIGGEDAGVGLG 276 PTHQ H + HG + GG G G G Sbjct: 230 PTHQTHHHHHHHQHGGGVGGGGGGGGGGGG 259 >AY341219-1|AAR13783.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 57 FVSQSNSFATKLYQRIS 73 >AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 57 FVSQSNSFATKLYQRIS 73 >AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 57 FVSQSNSFATKLYQRIS 73 >AY341215-1|AAR13779.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 57 FVSQSNSFATKLYQRIS 73 >AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. Length = 395 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 12 FVSQSNSFATKLYQRIS 28 >AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. Length = 380 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 12 FVSQSNSFATKLYQRIS 28 >AJ420785-2|CAD12782.1| 382|Anopheles gambiae serpin protein. Length = 382 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 12 FVSQSNSFATKLYQRIS 28 >AJ420785-1|CAD12781.1| 379|Anopheles gambiae serpin protein. Length = 379 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 12 FVSQSNSFATKLYQRIS 28 >AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine protease inhibitor protein. Length = 380 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 12 FVSQSNSFATKLYQRIS 28 >AJ271352-1|CAB69784.1| 379|Anopheles gambiae putative serine protease inhibitor protein. Length = 379 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+RIS Sbjct: 12 FVSQSNSFATKLYQRIS 28 >AY341218-1|AAR13782.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 23.8 bits (49), Expect = 4.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 403 FISSSNIFSKYLYRRIS 353 F+S SN F+ LY+R+S Sbjct: 57 FVSQSNSFATKLYQRVS 73 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 4.1 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = -2 Query: 184 RVLIRPSLGTCRLRRDRHRPAPDPVPERRGNRSGHTSLSHLF 59 R + + T +R R P P P P G R+ SL + Sbjct: 1107 RTSLYSARNTSEEQRGRRHPTPSPPPRAVGRRAEVRSLGERY 1148 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 5.4 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 67 EKEKYDPNGFRDALVQGLERAGGDLDAAYKYLDSAGSKL 183 EK K + N RDA V+ LER D K +D KL Sbjct: 1283 EKPKQESN--RDADVKDLERTIWDRSKQLKIIDLGALKL 1319 >EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.2 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +2 Query: 32 YRVNGSRPEKEMRKRSMTRTVSATLWYRVWSGPVAISTQPTST*TRPDQNSTTDA 196 YRVNG +P EM R + +W+ V T PD +S T+A Sbjct: 3 YRVNGPKP--EMLARVGAQVAGGFMWWWVLRHLFHEYEHITGEFDYPDPSSWTNA 55 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 7.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 377 GKNVRRGNEKGSGLLERLRSRTAASS 454 G R G+ GSG R RSR+ + S Sbjct: 1082 GSGSRAGSRAGSGSRSRSRSRSRSRS 1107 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 22.6 bits (46), Expect = 9.5 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +2 Query: 344 IRETDASVQVLGKNVRRGNEKGSGLLERLRSRTAASSWPRMTALWIGNGCVPPSVC 511 +R+ S+ + V+ G+E L R+R ++SSW +G + SVC Sbjct: 59 LRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRSSSSWAMEFDEETVDGRMVKSVC 114 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +3 Query: 318 DTMRNFEQVFVKLMRRYKYLEKMFEEEMKK 407 D M+ + + + KY+E E M+K Sbjct: 338 DVMKQHSSITYEAVHEMKYIEMCINESMRK 367 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,866 Number of Sequences: 2352 Number of extensions: 16405 Number of successful extensions: 130 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -