BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1220 (570 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RN17 Cluster: Putative uncharacterized protein PY0200... 35 1.5 UniRef50_Q7RMS2 Cluster: CCAAT-box DNA binding protein subunit B... 35 1.5 UniRef50_UPI00015ADD14 Cluster: vomeronasal 2 receptor 598; n=1;... 33 3.6 UniRef50_UPI00006A1B66 Cluster: UPI00006A1B66 related cluster; n... 33 6.2 >UniRef50_Q7RN17 Cluster: Putative uncharacterized protein PY02008; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY02008 - Plasmodium yoelii yoelii Length = 1042 Score = 34.7 bits (76), Expect = 1.5 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = -3 Query: 445 NKFSLLWTNYM*TKSEILSNSLKQLLVNCYLHTNDAKTYKILIALLKVFAQPNNVNVFVV 266 N FS N + +I N +K +N Y H K K+ +A+LK+ N+ + V Sbjct: 530 NNFSPYDNNIL-MNEKIKQNVIKTFKINKYEHVRSRKKKKVKLAILKMLRNNKNIAPYDV 588 Query: 265 MDVRYKKK 242 + + KKK Sbjct: 589 IKEKKKKK 596 >UniRef50_Q7RMS2 Cluster: CCAAT-box DNA binding protein subunit B; n=1; Plasmodium yoelii yoelii|Rep: CCAAT-box DNA binding protein subunit B - Plasmodium yoelii yoelii Length = 961 Score = 34.7 bits (76), Expect = 1.5 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 8/103 (7%) Frame = -3 Query: 454 KSFNKFSLLWTNYM*TKSE--ILSNSLKQL------LVNCYLHTNDAKTYKILIALLKVF 299 K NK+S + NY+ TK + N L Q L+N +H ++ +L F Sbjct: 273 KDKNKYSKYYINYILTKKLKLFIKNDLIQFINRNINLINNNIHLKIISVKRLFSKVLNNF 332 Query: 298 AQPNNVNVFVVMDVRYKKKIVLKYSCFNKQTRVHWKVNNK*ST 170 N+ N + + Y +++KY +NK + + NK ST Sbjct: 333 KLSNSSNNLFIYQILYS--MIIKYGKYNKNKIIKKNIMNKLST 373 >UniRef50_UPI00015ADD14 Cluster: vomeronasal 2 receptor 598; n=1; Monodelphis domestica|Rep: vomeronasal 2 receptor 598 - Monodelphis domestica Length = 748 Score = 33.5 bits (73), Expect = 3.6 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 180 LLLTFQCTRVCLLKQEYFSTIFFLYLTSITTKTLTL 287 L L T CLL+Q F T+F + ++SI +KTLT+ Sbjct: 495 LFLGHPTTVTCLLRQTTFGTLFTVAISSILSKTLTV 530 >UniRef50_UPI00006A1B66 Cluster: UPI00006A1B66 related cluster; n=2; Xenopus tropicalis|Rep: UPI00006A1B66 UniRef100 entry - Xenopus tropicalis Length = 789 Score = 32.7 bits (71), Expect = 6.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 201 TRVCLLKQEYFSTIFFLYLTSITTKTLTL 287 T +CLL+Q FS IF + ++S+ KT+T+ Sbjct: 571 TAICLLRQVVFSLIFTVAVSSVVAKTITV 599 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,936,961 Number of Sequences: 1657284 Number of extensions: 9858962 Number of successful extensions: 22540 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22537 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 38738010471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -