BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1218 (316 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 1.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 5.4 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 19 9.4 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 19 9.4 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.6 bits (46), Expect = 1.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 97 GPASSAACWPPARTGCAS 44 GP AAC P +R G S Sbjct: 137 GPVRPAACTPDSRVGYGS 154 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.2 bits (40), Expect = 5.4 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 37 AEPMRTQCALAASKLLKKPDQSRAVALCSHLFWKGTRDGRPVW 165 A P Q + +L++ SRA L + L+ TR VW Sbjct: 190 ARPRSLQFVDSEGNILEEFVLSRAGGLVNSLYQNATRKVCGVW 232 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 19.4 bits (38), Expect = 9.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 5 SSRSIVLALRTRSRCAPSARWRP 73 SSRS A +++ R AP++R P Sbjct: 246 SSRSHQPATKSKPRPAPASRNAP 268 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 19.4 bits (38), Expect = 9.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 228 LLGHAGRLLQAVQRA 184 LLG AG+LL +V A Sbjct: 112 LLGDAGKLLASVHFA 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,532 Number of Sequences: 336 Number of extensions: 897 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5836655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -