BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1217 (396 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 3e-19 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 5e-18 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 1e-17 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 1e-17 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 1e-15 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 2e-15 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-15 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 5e-15 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 1e-14 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 8e-14 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-13 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 6e-13 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-12 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 3e-12 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 67 6e-12 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-12 SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-12 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 7e-12 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 66 1e-11 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 66 1e-11 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 66 1e-11 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 66 1e-11 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 66 1e-11 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 66 1e-11 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 66 1e-11 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 66 1e-11 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 66 1e-11 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 66 1e-11 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 66 1e-11 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 66 1e-11 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 66 1e-11 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 66 1e-11 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 66 1e-11 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 66 1e-11 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 66 1e-11 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 66 1e-11 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 66 1e-11 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 66 1e-11 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 66 1e-11 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 66 1e-11 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 66 1e-11 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 66 1e-11 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 66 1e-11 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 66 1e-11 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 66 1e-11 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 66 1e-11 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 66 1e-11 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 66 1e-11 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 66 1e-11 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 66 1e-11 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 66 1e-11 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 66 1e-11 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 66 1e-11 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 66 1e-11 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 66 1e-11 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 66 1e-11 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 66 1e-11 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 66 1e-11 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 66 1e-11 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 66 1e-11 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 66 1e-11 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 66 1e-11 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 66 1e-11 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 66 1e-11 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 66 1e-11 SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3) 66 1e-11 SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7) 66 1e-11 SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 66 1e-11 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 66 1e-11 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_20345| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_20175| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_20124| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19473| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_19023| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 66 1e-11 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_18032| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 66 1e-11 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 66 1e-11 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 66 1e-11 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16611| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16365| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_16003| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15793| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15304| Best HMM Match : Herpes_UL49_5 (HMM E-Value=1.3) 66 1e-11 SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14400| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14226| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_14098| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 66 1e-11 SB_13829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13824| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13406| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13252| Best HMM Match : Ligase_CoA (HMM E-Value=9.1) 66 1e-11 SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 66 1e-11 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_12650| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_11368| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_10030| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9824| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9660| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8518| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 66 1e-11 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 66 1e-11 SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48) 66 1e-11 SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08) 66 1e-11 SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9) 66 1e-11 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7) 66 1e-11 SB_6528| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 66 1e-11 SB_6371| Best HMM Match : PSI_PsaJ (HMM E-Value=2.6) 66 1e-11 SB_6347| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6048| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_6044| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 91.1 bits (216), Expect = 3e-19 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = +3 Query: 228 NSPYSESYYIHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 NSPY IHWP+FYN VTGKTLALPNLI L HIPLSPA + EEARTDRP QQL Sbjct: 75 NSPYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQL 130 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 88.6 bits (210), Expect = 2e-18 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +3 Query: 258 HWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 HWP+FYN VTGKTLALPNLI L HIPLSPA RNSEEARTDRP QQL Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQL 50 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 87.0 bits (206), Expect = 5e-18 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGKTLALPNLI L HIPLSPA NSEEARTDRP QQL Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQL 52 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 85.8 bits (203), Expect = 1e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 258 HWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQ 392 HWP+FYNDVTGKTLALPNLI L HIP +WRNS+EARTDRP QQ Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNSQEARTDRPSQQ 49 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 85.8 bits (203), Expect = 1e-17 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGKTLALPNLI L HIP +WRNSEEARTDRP QQL Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQL 52 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 79.0 bits (186), Expect = 1e-15 Identities = 37/47 (78%), Positives = 39/47 (82%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHW +FYN VTGKTLALPNLI L HIPLSPA +EEARTDRP QQL Sbjct: 42 IHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQL 88 Score = 28.3 bits (60), Expect = 2.4 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 205 LPGGARYPIRPIVSRITFTGRPFTTT*LGKPWRYPT*SSCITSPFRQLGVIAK 363 +PG + +RP+VSRIT F GK P + P GVIA+ Sbjct: 25 IPGIFQGNLRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAE 77 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 78.2 bits (184), Expect = 2e-15 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGKTLALPNLI L P +WRNSEEARTDRP QQL Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQL 52 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.0 bits (181), Expect = 5e-15 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 378 DRYGPLRYYAKLAKGGCDARRLSWVTPGFSQSRRCKRSASE 256 DR GPLRYYA KGGC ARRLSWVTPGFSQSRRCK +ASE Sbjct: 69 DRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASE 109 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 77.0 bits (181), Expect = 5e-15 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGKTLALPNLI L P +WRNSEEARTDRP Q+L Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRL 52 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 75.8 bits (178), Expect = 1e-14 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGKTLALPNL L HIPL + SEEARTDRP QQL Sbjct: 6 IHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQL 52 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 72.9 bits (171), Expect = 8e-14 Identities = 35/47 (74%), Positives = 36/47 (76%) Frame = -1 Query: 396 ATVGKVDRYGPLRYYAKLAKGGCDARRLSWVTPGFSQSRRCKRSASE 256 ATVGK DR GPLRYYA KG RLSWVTPGFSQSRRCK +ASE Sbjct: 3 ATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASE 49 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 70.9 bits (166), Expect = 3e-13 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -1 Query: 390 VGKVDRYGPLRYYAKLAKGGCDARRLSWVTPGFSQSRRCKRSASE 256 +GK DR GPLRYYA KG RRLSWVTPGFSQSRRCK +ASE Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASE 49 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 70.1 bits (164), Expect = 6e-13 Identities = 34/47 (72%), Positives = 35/47 (74%) Frame = -1 Query: 396 ATVGKVDRYGPLRYYAKLAKGGCDARRLSWVTPGFSQSRRCKRSASE 256 ATVGK DR GPLRYYA KG A RLS TPGFSQSRRCK +ASE Sbjct: 32 ATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASE 78 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 68.9 bits (161), Expect = 1e-12 Identities = 32/48 (66%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLAL-PNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGK P+L L +IPL +WRNSEEARTDRP QQL Sbjct: 6 IHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQL 53 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 3e-12 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 348 KLAKGGCDARRLSWVTPGFSQSRRCKRSASECNTTHYRANW 226 +LAKGGC ARRLSWVTPGF KR CNTTHYRANW Sbjct: 40 QLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 38.3 bits (85), Expect = 0.002 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -3 Query: 394 NCWKGRSVRASSLLRQAGERG 332 NCW+GRSVRASSLLRQ + G Sbjct: 25 NCWEGRSVRASSLLRQLAKGG 45 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 66.9 bits (156), Expect = 6e-12 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +2 Query: 272 LQRRDWENPGVTQLNRLASHPPFASLA**RRGPYRSTFPTV 394 LQRRDWENPGVTQLNRLA+HPPFAS R P+RS FPTV Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTV 387 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.5 bits (155), Expect = 7e-12 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 30 SSRAAATAVELQFALYESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFAS 80 Score = 38.7 bits (86), Expect = 0.002 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Frame = +3 Query: 243 ESYYIHWPTFYNDVTG----KTLALPNLIVLHHIPLSP---AWRNSEEARTDRPFQQL 395 E + + ++YN + G + P + L+ + P +WRNSEEARTDRP QQL Sbjct: 39 ELQFALYESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 96 >SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.5 bits (155), Expect = 7e-12 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 8 SSRAAATAVALQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 58 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 53 HPPFA-SWRNSEEARTDRPSQQL 74 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.5 bits (155), Expect = 7e-12 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 38.7 bits (86), Expect = 0.002 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Frame = +3 Query: 243 ESYYIHWPTFYNDVTG----KTLALPNLIVLHHIPLSP---AWRNSEEARTDRPFQQL 395 E + + ++YN + G + P + L+ + P +WRNSEEARTDRP QQL Sbjct: 52 ELQFALYESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 109 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 66.1 bits (154), Expect = 1e-11 Identities = 35/66 (53%), Positives = 38/66 (57%) Frame = +3 Query: 198 AATSRGGPVPNSPYSESYYIHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTD 377 AAT G P+ P IHWP FYN TGKTLA L L P +WRNS+EAR D Sbjct: 32 AATDGGAPI--RPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARAD 89 Query: 378 RPFQQL 395 RP QQL Sbjct: 90 RPSQQL 95 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.1 bits (154), Expect = 1e-11 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = +3 Query: 255 IHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 IHWP+FYN VTGKTL++ L L P +WRNSEEARTDRP QQL Sbjct: 6 IHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 52 >SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 66.1 bits (154), Expect = 1e-11 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 188 AGSSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 + SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 69 SSSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 121 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 116 HPPFA-SWRNSEEARTDRPSQQL 137 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 66.1 bits (154), Expect = 1e-11 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 395 QLLERSIGTGLFAITPSWRKGDVMQDD-*VG*RQGFPSHVVVKGRPVN 255 QLL R+IG GLFAITP+ KGDV+Q D +G RQGFPSH VVK RPVN Sbjct: 45 QLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVN 92 Score = 34.7 bits (76), Expect = 0.028 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 297 GFSQSRRCKRSASECNTTHYRANW 226 GF KR CNTTHYRANW Sbjct: 79 GFPSHDVVKRRPVNCNTTHYRANW 102 >SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 66.1 bits (154), Expect = 1e-11 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 188 AGSSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 + SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 70 SASSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 122 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 117 HPPFA-SWRNSEEARTDRPSQQL 138 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 13 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 63 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 58 HPPFA-SWRNSEEARTDRPSQQL 79 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 40 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 90 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 85 HPPFA-SWRNSEEARTDRPSQQL 106 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 48 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 98 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 93 HPPFA-SWRNSEEARTDRPSQQL 114 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 24 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 74 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 69 HPPFA-SWRNSEEARTDRPSQQL 90 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 31 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 81 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 76 HPPFA-SWRNSEEARTDRPSQQL 97 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 47 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 97 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 92 HPPFA-SWRNSEEARTDRPSQQL 113 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 35 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 85 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 80 HPPFA-SWRNSEEARTDRPSQQL 101 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 61 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 111 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 106 HPPFA-SWRNSEEARTDRPSQQL 127 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 81 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 131 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 126 HPPFA-SWRNSEEARTDRPSQQL 147 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 121 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 171 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 166 HPPFA-SWRNSEEARTDRPSQQL 187 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 38 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 88 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 83 HPPFA-SWRNSEEARTDRPSQQL 104 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 51 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 101 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 96 HPPFA-SWRNSEEARTDRPSQQL 117 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 34 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 84 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 79 HPPFA-SWRNSEEARTDRPSQQL 100 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 47 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 97 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 92 HPPFA-SWRNSEEARTDRPSQQL 113 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 73 HPPFA-SWRNSEEARTDRPSQQL 94 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 15 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 65 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 60 HPPFA-SWRNSEEARTDRPSQQL 81 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 79 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 129 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 124 HPPFA-SWRNSEEARTDRPSQQL 145 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 36 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 86 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 81 HPPFA-SWRNSEEARTDRPSQQL 102 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 23 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 73 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 68 HPPFA-SWRNSEEARTDRPSQQL 89 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 32 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 82 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 77 HPPFA-SWRNSEEARTDRPSQQL 98 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 33 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 83 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 78 HPPFA-SWRNSEEARTDRPSQQL 99 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 46 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 96 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 91 HPPFA-SWRNSEEARTDRPSQQL 112 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 89 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 139 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 134 HPPFA-SWRNSEEARTDRPSQQL 155 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 45 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 95 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 90 HPPFA-SWRNSEEARTDRPSQQL 111 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 27 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 77 Score = 34.7 bits (76), Expect = 0.028 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRN+E+ARTDRP QQL Sbjct: 72 HPPFA-SWRNNEKARTDRPSQQL 93 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 139 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 189 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 184 HPPFA-SWRNSEEARTDRPSQQL 205 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 30 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 80 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 75 HPPFA-SWRNSEEARTDRPSQQL 96 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 20 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 70 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 65 HPPFA-SWRNSEEARTDRPSQQL 86 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 19 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 69 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 64 HPPFA-SWRNSEEARTDRPSQQL 85 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 87 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 137 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 132 HPPFA-SWRNSEEARTDRPSQQL 153 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 36 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 86 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 81 HPPFA-SWRNSEEARTDRPSQQL 102 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 73 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 123 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 118 HPPFA-SWRNSEEARTDRPSQQL 139 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 21 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 71 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 66 HPPFA-SWRNSEEARTDRPSQQL 87 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 125 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 175 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 170 HPPFA-SWRNSEEARTDRPSQQL 191 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 33 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 83 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 78 HPPFA-SWRNSEEARTDRPSQQL 99 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 35 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 85 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 80 HPPFA-SWRNSEEARTDRPSQQL 101 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 20 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 70 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 65 HPPFA-SWRNSEEARTDRPSQQL 86 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 34 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 84 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 79 HPPFA-SWRNSEEARTDRPSQQL 100 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 73 HPPFA-SWRNSEEARTDRPSQQL 94 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 104 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 154 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 149 HPPFA-SWRNSEEARTDRPSQQL 170 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 146 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 196 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 191 HPPFA-SWRNSEEARTDRPSQQL 212 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 61 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 111 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 106 HPPFA-SWRNSEEARTDRPSQQL 127 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 35 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 85 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 80 HPPFA-SWRNSEEARTDRPSQQL 101 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 19 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 69 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 64 HPPFA-SWRNSEEARTDRPSQQL 85 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 67 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 117 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 112 HPPFA-SWRNSEEARTDRPSQQL 133 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 441 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 491 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 486 HPPFA-SWRNSEEARTDRPSQQL 507 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 32 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 82 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 77 HPPFA-SWRNSEEARTDRPSQQL 98 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 17 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 67 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 62 HPPFA-SWRNSEEARTDRPSQQL 83 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 80 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 130 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 125 HPPFA-SWRNSEEARTDRPSQQL 146 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 45 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 95 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 90 HPPFA-SWRNSEEARTDRPSQQL 111 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 67 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 117 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 112 HPPFA-SWRNSEEARTDRPSQQL 133 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 25 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 75 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 70 HPPFA-SWRNSEEARTDRPSQQL 91 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 48 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 98 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 93 HPPFA-SWRNSEEARTDRPSQQL 114 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 50 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 100 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 95 HPPFA-SWRNSEEARTDRPSQQL 116 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 25 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 75 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 70 HPPFA-SWRNSEEARTDRPSQQL 91 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 112 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 162 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 157 HPPFA-SWRNSEEARTDRPSQQL 178 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 158 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 208 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 203 HPPFA-SWRNSEEARTDRPSQQL 224 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 55 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 105 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 100 HPPFA-SWRNSEEARTDRPSQQL 121 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 31 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 81 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 76 HPPFA-SWRNSEEARTDRPSQQL 97 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 218 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 268 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 263 HPPFA-SWRNSEEARTDRPSQQL 284 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 88 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 138 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 133 HPPFA-SWRNSEEARTDRPSQQL 154 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 23 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 73 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 68 HPPFA-SWRNSEEARTDRPSQQL 89 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 23 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 73 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 68 HPPFA-SWRNSEEARTDRPSQQL 89 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 15 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 65 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 60 HPPFA-SWRNSEEARTDRPSQQL 81 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 65 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 115 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 110 HPPFA-SWRNSEEARTDRPSQQL 131 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 55 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 105 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 100 HPPFA-SWRNSEEARTDRPSQQL 121 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 40 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 90 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 85 HPPFA-SWRNSEEARTDRPSQQL 106 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 50 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 100 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 95 HPPFA-SWRNSEEARTDRPSQQL 116 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 36.3 bits (80), Expect = 0.009 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSE+ARTDRP QQL Sbjct: 59 HPPFA-SWRNSEQARTDRPSQQL 80 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 47 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 97 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 92 HPPFA-SWRNSEEARTDRPSQQL 113 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 91 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 141 Score = 37.9 bits (84), Expect = 0.003 Identities = 34/108 (31%), Positives = 46/108 (42%), Gaps = 1/108 (0%) Frame = +3 Query: 75 CLVAGLTVTVDPCQSFNLASEQVNFLEVTA-GFLRFDDELGQAATSRGGPVPNSPYSESY 251 C++ GL T+ F L+ V + V FL+ A + + + Y ESY Sbjct: 52 CIIMGLCNTLGTTAGF-LSPLLVGIVTVNKIEFLQPGGSTSSRAAATAVELQFALY-ESY 109 Query: 252 YIHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 Y + + L L P +WRNSEEARTDRP QQL Sbjct: 110 YNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 157 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 30 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 80 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 75 HPPFA-SWRNSEEARTDRPSQQL 96 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 18 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 68 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 63 HPPFA-SWRNSEEARTDRPSQQL 84 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 115 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 165 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 160 HPPFA-SWRNSEEARTDRPSQQL 181 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 20 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 70 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 65 HPPFA-SWRNSEEARTDRPSQQL 86 >SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) Length = 163 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 50 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 100 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 95 HPPFA-SWRNSEEARTDRPSQQL 116 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 121 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 171 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 166 HPPFA-SWRNSEEARTDRPSQQL 187 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 36 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 86 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 81 HPPFA-SWRNSEEARTDRPSQQL 102 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 82 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 132 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 127 HPPFA-SWRNSEEARTDRPSQQL 148 >SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) Length = 261 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 148 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 198 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 193 HPPFA-SWRNSEEARTDRPSQQL 214 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 24 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 74 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 69 HPPFA-SWRNSEEARTDRPSQQL 90 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 56 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 106 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 101 HPPFA-SWRNSEEARTDRPSQQL 122 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 101 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 151 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 146 HPPFA-SWRNSEEARTDRPSQQL 167 >SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 15 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 65 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 60 HPPFA-SWRNSEEARTDRPSQQL 81 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 238 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 288 Score = 62.5 bits (145), Expect = 1e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 254 HSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 367 NSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 397 Score = 48.0 bits (109), Expect = 3e-06 Identities = 27/56 (48%), Positives = 30/56 (53%) Frame = +3 Query: 228 NSPYSESYYIHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 NSPYSESYY + + L L P +WRNSEEARTDRP QQL Sbjct: 358 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 413 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 283 HPPFA-SWRNSEEARTDRPSQQL 304 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 69 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 119 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 114 HPPFA-SWRNSEEARTDRPSQQL 135 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 24 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 74 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 69 HPPFA-SWRNSEEARTDRPSQQL 90 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 26 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 76 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 71 HPPFA-SWRNSEEARTDRPSQQL 92 >SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 73 HPPFA-SWRNSEEARTDRPSQQL 94 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 106 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 156 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 151 HPPFA-SWRNSEEARTDRPSQQL 172 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 52 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 102 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 97 HPPFA-SWRNSEEARTDRPSQQL 118 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 27 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 77 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 72 HPPFA-SWRNSEEARTDRPSQQL 93 >SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 21 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 71 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 66 HPPFA-SWRNSEEARTDRPSQQL 87 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAPTAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 52 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 102 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 97 HPPFA-SWRNSEEARTDRPSQQL 118 >SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 74 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 124 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 119 HPPFA-SWRNSEEARTDRPSQQL 140 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 73 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 123 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 118 HPPFA-SWRNSEEARTDRPSQQL 139 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 29 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 79 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 74 HPPFA-SWRNSEEARTDRPSQQL 95 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 21 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 71 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 66 HPPFA-SWRNSEEARTDRPSQQL 87 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 51 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 101 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 96 HPPFA-SWRNSEEARTDRPSQQL 117 >SB_16189| Best HMM Match : rve (HMM E-Value=0.3) Length = 595 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 482 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 532 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 527 HPPFA-SWRNSEEARTDRPSQQL 548 >SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 36 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 86 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 81 HPPFA-SWRNSEEARTDRPSQQL 102 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 107 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 157 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 152 HPPFA-SWRNSEEARTDRPSQQL 173 >SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 32 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 82 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 77 HPPFA-SWRNSEEARTDRPSQQL 98 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 66 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 116 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 111 HPPFA-SWRNSEEARTDRPSQQL 132 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 36 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 86 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 81 HPPFA-SWRNSEEARTDRPSQQL 102 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 27 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 77 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 72 HPPFA-SWRNSEEARTDRPSQQL 93 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 31 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 81 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 76 HPPFA-SWRNSEEARTDRPSQQL 97 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 64 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 114 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 109 HPPFA-SWRNSEEARTDRPSQQL 130 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 82 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 132 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 127 HPPFA-SWRNSEEARTDRPSQQL 148 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 65 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 115 Score = 39.9 bits (89), Expect = 7e-04 Identities = 30/88 (34%), Positives = 38/88 (43%) Frame = +3 Query: 132 SEQVNFLEVTAGFLRFDDELGQAATSRGGPVPNSPYSESYYIHWPTFYNDVTGKTLALPN 311 +EQ FL FL+ A + + + Y ESYY + + Sbjct: 45 NEQTRFLNNQIEFLQPGGSTSSRAAATAVELQFALY-ESYYNSLAVVLQRRDWENPGVTQ 103 Query: 312 LIVLHHIPLSPAWRNSEEARTDRPFQQL 395 L L P +WRNSEEARTDRP QQL Sbjct: 104 LNRLAAHPPFASWRNSEEARTDRPSQQL 131 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 112 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 162 Score = 38.7 bits (86), Expect = 0.002 Identities = 33/121 (27%), Positives = 50/121 (41%) Frame = +3 Query: 33 TPAFVAVSDVRIKVCLVAGLTVTVDPCQSFNLASEQVNFLEVTAGFLRFDDELGQAATSR 212 T + V I + ++ +T+TV + + + +T FL+ A + Sbjct: 59 TTTVIITITVIITITVIITITITVIITITITITVIITITVIITIEFLQPGGSTSSRAAAT 118 Query: 213 GGPVPNSPYSESYYIHWPTFYNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQ 392 + + Y ESYY + + L L P +WRNSEEARTDRP QQ Sbjct: 119 AVELQFALY-ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 177 Query: 393 L 395 L Sbjct: 178 L 178 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 44 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 94 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 89 HPPFA-SWRNSEEARTDRPSQQL 110 >SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 22 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 72 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 67 HPPFA-SWRNSEEARTDRPSQQL 88 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 73 HPPFA-SWRNSEEARTDRPSQQL 94 >SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 19 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 69 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 64 HPPFA-SWRNSEEARTDRPSQQL 85 >SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) Length = 271 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 158 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 208 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 203 HPPFA-SWRNSEEARTDRPSQQL 224 >SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 86 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 136 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 131 HPPFA-SWRNSEEARTDRPSQQL 152 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 239 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 289 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 284 HPPFA-SWRNSEEARTDRPSQQL 305 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 15 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 65 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 60 HPPFA-SWRNSEEARTDRPSQQL 81 >SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 30 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 80 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 75 HPPFA-SWRNSEEARTDRPSQQL 96 >SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 42 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 92 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 87 HPPFA-SWRNSEEARTDRPSQQL 108 >SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 16 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 66 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 61 HPPFA-SWRNSEEARTDRPSQQL 82 >SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 35 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 85 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 80 HPPFA-SWRNSEEARTDRPSQQL 101 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 100 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 150 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 145 HPPFA-SWRNSEEARTDRPSQQL 166 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 38.3 bits (85), Expect = 0.002 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = +3 Query: 99 TVDPCQSFNLASEQVNFLEVTAGFLRFDDELGQAATSRGGPVPNSPYS--ESYYIHWPTF 272 T+D + +EQ + E+ + F G ++ ++ ESYY Sbjct: 9 TIDLSVWREIRNEQCDRTEIEINSIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVV 68 Query: 273 YNDVTGKTLALPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 + + L L P +WRNSEEARTDRP QQL Sbjct: 69 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 109 >SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 32 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 82 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 77 HPPFA-SWRNSEEARTDRPSQQL 98 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 24 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 74 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 69 HPPFA-SWRNSEEARTDRPSQQL 90 >SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 44 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 94 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 89 HPPFA-SWRNSEEARTDRPSQQL 110 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 47 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 97 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 92 HPPFA-SWRNSEEARTDRPSQQL 113 >SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 23 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 73 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 68 HPPFA-SWRNSEEARTDRPSQQL 89 >SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 78 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 128 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 123 HPPFA-SWRNSEEARTDRPSQQL 144 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 44 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 94 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 89 HPPFA-SWRNSEEARTDRPSQQL 110 >SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 70 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 120 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 115 HPPFA-SWRNSEEARTDRPSQQL 136 >SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) Length = 188 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 37 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 87 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 82 HPPFA-SWRNSEEARTDRPSQQL 103 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 27 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 77 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 72 HPPFA-SWRNSEEARTDRPSQQL 93 >SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 21 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 71 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 66 HPPFA-SWRNSEEARTDRPSQQL 87 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 48 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 98 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 93 HPPFA-SWRNSEEARTDRPSQQL 114 >SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 18 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 68 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 63 HPPFA-SWRNSEEARTDRPSQQL 84 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 37 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 87 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 82 HPPFA-SWRNSEEARTDRPSQQL 103 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 20 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 70 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 65 HPPFA-SWRNSEEARTDRPSQQL 86 >SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 56 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 106 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 101 HPPFA-SWRNSEEARTDRPSQQL 122 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 22 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 72 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 67 HPPFA-SWRNSEEARTDRPSQQL 88 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 20 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 70 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 65 HPPFA-SWRNSEEARTDRPSQQL 86 >SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 38.3 bits (85), Expect = 0.002 Identities = 28/84 (33%), Positives = 37/84 (44%) Frame = +3 Query: 144 NFLEVTAGFLRFDDELGQAATSRGGPVPNSPYSESYYIHWPTFYNDVTGKTLALPNLIVL 323 N + +T FL+ A + + + Y ESYY + + L L Sbjct: 12 NIVGITIEFLQPGGSTSSRAAATAVELQFALY-ESYYNSLAVVLQRRDWENPGVTQLNRL 70 Query: 324 HHIPLSPAWRNSEEARTDRPFQQL 395 P +WRNSEEARTDRP QQL Sbjct: 71 AAHPPFASWRNSEEARTDRPSQQL 94 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 110 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 160 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 155 HPPFA-SWRNSEEARTDRPSQQL 176 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 73 HPPFA-SWRNSEEARTDRPSQQL 94 >SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 25 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 75 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 70 HPPFA-SWRNSEEARTDRPSQQL 91 >SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 13 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 63 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 58 HPPFA-SWRNSEEARTDRPSQQL 79 >SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 34 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 84 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 79 HPPFA-SWRNSEEARTDRPSQQL 100 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 31 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 81 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 76 HPPFA-SWRNSEEARTDRPSQQL 97 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 48 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 98 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 93 HPPFA-SWRNSEEARTDRPSQQL 114 >SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 85 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 135 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 130 HPPFA-SWRNSEEARTDRPSQQL 151 >SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 17 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 67 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 62 HPPFA-SWRNSEEARTDRPSQQL 83 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 13 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 63 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 58 HPPFA-SWRNSEEARTDRPSQQL 79 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 40 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 90 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 85 HPPFA-SWRNSEEARTDRPSQQL 106 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 36 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 86 Score = 35.9 bits (79), Expect = 0.012 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSE+ARTDRP QQL Sbjct: 81 HPPFA-SWRNSEKARTDRPSQQL 102 >SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) Length = 174 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 61 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 111 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 106 HPPFA-SWRNSEEARTDRPSQQL 127 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 19 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 69 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 64 HPPFA-SWRNSEEARTDRPSQQL 85 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 23 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 73 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 68 HPPFA-SWRNSEEARTDRPSQQL 89 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 75 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 125 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 120 HPPFA-SWRNSEEARTDRPSQQL 141 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 54 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 104 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 99 HPPFA-SWRNSEEARTDRPSQQL 120 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 266 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 316 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 311 HPPFA-SWRNSEEARTDRPSQQL 332 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 32 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 82 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 77 HPPFA-SWRNSEEARTDRPSQQL 98 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 44 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 94 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 89 HPPFA-SWRNSEEARTDRPSQQL 110 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 61 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 111 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 106 HPPFA-SWRNSEEARTDRPSQQL 127 >SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 20 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 70 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 65 HPPFA-SWRNSEEARTDRPSQQL 86 >SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 57 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 107 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 102 HPPFA-SWRNSEEARTDRPSQQL 123 >SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 24 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 74 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 69 HPPFA-SWRNSEEARTDRPSQQL 90 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 43 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 93 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 88 HPPFA-SWRNSEEARTDRPSQQL 109 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 48 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 98 Score = 38.3 bits (85), Expect = 0.002 Identities = 31/91 (34%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +3 Query: 126 LASEQVNFLEVTA-GFLRFDDELGQAATSRGGPVPNSPYSESYYIHWPTFYNDVTGKTLA 302 + +EQV L +T FL+ A + + + Y ESYY + Sbjct: 25 ITTEQVVILYITIIEFLQPGGSTSSRAAATAVELQFALY-ESYYNSLAVVLQRRDWENPG 83 Query: 303 LPNLIVLHHIPLSPAWRNSEEARTDRPFQQL 395 + L L P +WRNSEEARTDRP QQL Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQQL 114 >SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 12 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 62 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 57 HPPFA-SWRNSEEARTDRPSQQL 78 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 32 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 82 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 77 HPPFA-SWRNSEEARTDRPSQQL 98 >SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 14 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 64 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 59 HPPFA-SWRNSEEARTDRPSQQL 80 >SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 40 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 90 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 85 HPPFA-SWRNSEEARTDRPSQQL 106 >SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 28 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 78 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 73 HPPFA-SWRNSEEARTDRPSQQL 94 >SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 15 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 65 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 60 HPPFA-SWRNSEEARTDRPSQQL 81 >SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 65.7 bits (153), Expect = 1e-11 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = +2 Query: 194 SSRNFQGGPGTQFAL**VVLHSLADLLQRRDWENPGVTQLNRLASHPPFAS 346 SSR QFAL +SLA +LQRRDWENPGVTQLNRLA+HPPFAS Sbjct: 54 SSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 104 Score = 37.5 bits (83), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 327 HIPLSPAWRNSEEARTDRPFQQL 395 H P + +WRNSEEARTDRP QQL Sbjct: 99 HPPFA-SWRNSEEARTDRPSQQL 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,939,315 Number of Sequences: 59808 Number of extensions: 281824 Number of successful extensions: 9327 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7777 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -