BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1216 (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0660 - 24071523-24071780,24071873-24072127,24072209-240723... 28 6.3 02_05_1346 - 35831261-35831371,35831609-35831779,35831850-358318... 27 8.4 >01_05_0660 - 24071523-24071780,24071873-24072127,24072209-24072380, 24072458-24072685,24072785-24072918,24073005-24073088, 24073231-24073521,24073599-24073931,24074016-24074266, 24074354-24074620,24074707-24074867,24074978-24075294, 24075386-24075667,24075753-24076054,24076147-24076237, 24076326-24076379,24076497-24076573,24076700-24076859, 24077129-24077213,24077421-24077630,24077736-24078097 Length = 1457 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 269 LYKIVLSSNGFIKHPRQTGSPLPCTVKKYF 180 LY +V+S G I+ P + G+P+ V+ YF Sbjct: 1391 LYGLVVSQFGDIETPMEDGTPVKVFVENYF 1420 >02_05_1346 - 35831261-35831371,35831609-35831779,35831850-35831888, 35831987-35832049,35832616-35832679,35832709-35832778, 35832866-35832934,35833101-35833186,35833670-35833800, 35834021-35834083,35834166-35834211,35834542-35834618, 35834690-35834724,35835480-35835542,35835632-35835719, 35836027-35836077,35836201-35836269 Length = 431 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 422 DLCKIHGKYLVLKGAAELNHFFLDE 348 D+CK HGKY K +E + LDE Sbjct: 221 DICKKHGKYFSAKTLSEHYKWALDE 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,415,406 Number of Sequences: 37544 Number of extensions: 225375 Number of successful extensions: 373 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -