BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1214 (562 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 25 2.2 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 9.0 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -2 Query: 312 INLSYTRKQCGLCIVKAINCFCYVYFIGKAILSYGGVYDL 193 ++LS+ +Q G +C V F I +YG + ++ Sbjct: 289 VDLSHMMQQLGKAYSNMYGIYCLVIFFTTIIATYGSLSEI 328 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 22.6 bits (46), Expect = 9.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 215 HMVVYMILLVTVLVELGKE 159 HM + +L+ L+ELG E Sbjct: 54 HMTIQTAVLIETLIELGAE 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,164 Number of Sequences: 2352 Number of extensions: 8517 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -