BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1214 (562 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024881-9|AAK71410.1| 588|Caenorhabditis elegans Hypothetical ... 28 5.3 Z81041-1|CAB02786.2| 362|Caenorhabditis elegans Hypothetical pr... 27 7.0 >AC024881-9|AAK71410.1| 588|Caenorhabditis elegans Hypothetical protein Y97E10B.1 protein. Length = 588 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 227 RLSYHMVVYMILLVTVLVELGKEFDAQPNLNISP 126 R HM +Y+I VT EL KE++ + + I P Sbjct: 223 RFGAHMNLYLISSVTSFYELMKEYEKEGYVTIQP 256 >Z81041-1|CAB02786.2| 362|Caenorhabditis elegans Hypothetical protein C27A7.2 protein. Length = 362 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 254 VFVMFILLA-RLSYHMVVYMILLVTVLVELGKEFDAQ 147 +F+M + A R HM +Y+I +V +L KE++ Q Sbjct: 122 IFLMHVHTAHRFGAHMHIYVISIVNAYYDLMKEYERQ 158 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,201,128 Number of Sequences: 27780 Number of extensions: 176572 Number of successful extensions: 346 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1155524042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -