BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1214 (562 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45290.1 68416.m04890 seven transmembrane MLO family protein ... 28 4.9 At2g01740.1 68415.m00103 pentatricopeptide (PPR) repeat-containi... 28 4.9 At1g09090.2 68414.m01015 respiratory burst oxidase protein B (Rb... 27 6.5 At1g09090.1 68414.m01014 respiratory burst oxidase protein B (Rb... 27 6.5 >At3g45290.1 68416.m04890 seven transmembrane MLO family protein / MLO-like protein 3 (MLO3) membrane protein Mlo3 [Arabidopsis thaliana] gi|14091576|gb|AAK53796; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 508 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 403 ISHYLLFLNSY*LEFISKIILKYQMKISLCY 495 I HY LFLN++ + FI + + +Q I+ CY Sbjct: 362 ILHYTLFLNTFEMAFI--VWITWQFGINSCY 390 >At2g01740.1 68415.m00103 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 559 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = -3 Query: 239 ILLARLSYHMVVYMILLVTVLVELGKEFDAQPNLNISPLSFSPDLL 102 +LL L+Y ++Y + ++VE + FD N ISP S DLL Sbjct: 469 LLLDLLAYTTLIYGLASKGLMVEARQVFDEMLNSGISPDSAVFDLL 514 >At1g09090.2 68414.m01015 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 843 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 284 VVYVL*RQLIVFVMFILLARLSYHMVVYMILLVTVLV 174 +VYVL LIV F+ L++ YH +M L V VL+ Sbjct: 489 IVYVL---LIVHGYFVYLSKEWYHKTTWMYLAVPVLL 522 >At1g09090.1 68414.m01014 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 622 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -3 Query: 284 VVYVL*RQLIVFVMFILLARLSYHMVVYMILLVTVLV 174 +VYVL LIV F+ L++ YH +M L V VL+ Sbjct: 489 IVYVL---LIVHGYFVYLSKEWYHKTTWMYLAVPVLL 522 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,326,896 Number of Sequences: 28952 Number of extensions: 151496 Number of successful extensions: 298 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -