BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1213 (520 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1026 - 33598275-33599561 31 0.42 >02_05_1026 - 33598275-33599561 Length = 428 Score = 31.5 bits (68), Expect = 0.42 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 356 PHFPTILTDQCWDLEYIKNKKKPFIFIVIAVLLLMFFFC-LIYL 228 P P ++ ++NK P I ++AVL ++FF C L++L Sbjct: 11 PQTPAAAASSASGIDGVENKISPSIVFIVAVLAIVFFVCGLLHL 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,140,665 Number of Sequences: 37544 Number of extensions: 91851 Number of successful extensions: 222 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 222 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -