BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1213 (520 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 4.3 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 21 7.6 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 21 7.6 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 4.3 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +3 Query: 345 WKMRDKCMCIEE 380 W+M CMC +E Sbjct: 69 WQMERSCMCCQE 80 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/35 (20%), Positives = 19/35 (54%) Frame = +3 Query: 348 KMRDKCMCIEELLGISRTVIYVICLFQINVFLSIA 452 +M D C ++ ++ +++ C++++N IA Sbjct: 108 EMIDSCSNVDSSDKCEKSFMFMKCMYEVNPIAFIA 142 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 146 LIIIFSYLLTLSLVSCQ 96 ++I+F LT+++V CQ Sbjct: 6 ILILFILSLTITIVMCQ 22 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,246 Number of Sequences: 438 Number of extensions: 1160 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -