BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1213 (520 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20320.1 68418.m02418 DEAD/DEAH box helicase, putative simila... 29 1.9 At4g22300.1 68417.m03225 phospholipase/carboxylesterase family p... 27 5.7 >At5g20320.1 68418.m02418 DEAD/DEAH box helicase, putative similar to CAF protein [Arabidopsis thaliana] GI:6102610; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF03368: Domain of unknown function, PF00636: RNase3 domain, PF00035: Double-stranded RNA binding motif Length = 1676 Score = 29.1 bits (62), Expect = 1.9 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -3 Query: 377 LYTHTFIPHFPTILTDQCWDLEYIKNKKKPFIFIVIAVLLLMFFFC-LIYLREIVLIY 207 L T F FP + Q DL + + + ++ L F FC IYL E++ Y Sbjct: 1314 LMTSYFFTVFPKLKPGQLTDLRSLSVNNEALANVAVSFSLKRFLFCESIYLHEVIEDY 1371 >At4g22300.1 68417.m03225 phospholipase/carboxylesterase family protein similar to acyl-protein thioesterase-1 [Homo sapiens] GI:9965372; contains Pfam profile PF02230: Phospholipase/Carboxylesterase family Length = 471 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 296 KKPFIFIVIAVLLLMFFFCLIYLRE 222 KKP + + IA+L +FFF +L + Sbjct: 247 KKPIVLLTIALLSSVFFFAFFFLNK 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,431,116 Number of Sequences: 28952 Number of extensions: 89284 Number of successful extensions: 244 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 244 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -