BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1208 (641 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53153-9|AAC69041.1| 511|Caenorhabditis elegans Hypothetical pr... 32 0.40 U64845-12|AAC48025.1| 475|Caenorhabditis elegans Hypothetical p... 28 4.9 U41545-7|AAK39136.1| 687|Caenorhabditis elegans Hypothetical pr... 28 4.9 AC024831-2|AAN63422.1| 502|Caenorhabditis elegans Hypothetical ... 28 6.5 AC024831-1|AAN63421.1| 500|Caenorhabditis elegans Hypothetical ... 28 6.5 >U53153-9|AAC69041.1| 511|Caenorhabditis elegans Hypothetical protein T19A5.5 protein. Length = 511 Score = 31.9 bits (69), Expect = 0.40 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 173 FRPFLNLQVFKFFKKAQCIFEC-PK 102 F FLNLQ+F++ + +CIF+C PK Sbjct: 97 FATFLNLQLFRYSVQPRCIFQCSPK 121 >U64845-12|AAC48025.1| 475|Caenorhabditis elegans Hypothetical protein F45F2.1 protein. Length = 475 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 27 ISFDYHNCIIYGGSYVHSIIGIALWLWTFKNTLCFLK 137 + F YH I+Y G + I + LW+W +LC K Sbjct: 61 VEFHYHRMIVYFG--LSHTIAVNLWIWA---SLCIAK 92 >U41545-7|AAK39136.1| 687|Caenorhabditis elegans Hypothetical protein C02F12.8 protein. Length = 687 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 113 ECPKPESNSNYRMNIASTIDNTIMI 39 +CP P N Y+ N+ ST+D + + Sbjct: 95 QCPNPYQNCGYQNNLVSTLDASFKV 119 >AC024831-2|AAN63422.1| 502|Caenorhabditis elegans Hypothetical protein Y55F3C.7b protein. Length = 502 Score = 27.9 bits (59), Expect = 6.5 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 331 HITYYICTFLAITEVFGFDIEV 396 ++ YY+C FLA+ + GF + + Sbjct: 335 NLLYYLCIFLAVCSIVGFTMNI 356 >AC024831-1|AAN63421.1| 500|Caenorhabditis elegans Hypothetical protein Y55F3C.7a protein. Length = 500 Score = 27.9 bits (59), Expect = 6.5 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 331 HITYYICTFLAITEVFGFDIEV 396 ++ YY+C FLA+ + GF + + Sbjct: 335 NLLYYLCIFLAVCSIVGFTMNI 356 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,353,139 Number of Sequences: 27780 Number of extensions: 251321 Number of successful extensions: 694 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -