BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1208 (641 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16190.1 68417.m02457 cysteine proteinase, putative contains ... 30 1.5 At2g21430.1 68415.m02550 cysteine proteinase A494, putative / th... 28 4.6 >At4g16190.1 68417.m02457 cysteine proteinase, putative contains similarity to papain-like cysteine proteinase isoform I GI:7381219 from [Ipomoea batatas] Length = 373 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 622 RKRGIMRSENNNGICWSGAGLSAPRA-HRPHILVTPIIIHSSRRQLADC 479 R++G + N G+C S SA A H L T ++ S +QL DC Sbjct: 147 REQGAVTPVKNQGMCGSCWSFSAIGALEGAHFLATKELVSLSEQQLVDC 195 >At2g21430.1 68415.m02550 cysteine proteinase A494, putative / thiol protease, putative identical to SP:P43295 Probable cysteine proteinase A494 precursor [Arabidopsis thaliana]; strong similarity to cysteine proteinase RD19A (thiol protease) GI:435618, SP:P43296 from [Arabidopsis thaliana] Length = 361 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 622 RKRGIMRSENNNGICWSGAGLSAPRA-HRPHILVTPIIIHSSRRQLADC 479 R RG + N G C S S A H L T ++ S +QL DC Sbjct: 139 RDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDC 187 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,342,960 Number of Sequences: 28952 Number of extensions: 223844 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -