BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1205 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp... 27 1.4 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 25 7.3 SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa... 25 7.3 >SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Spt6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1365 Score = 27.5 bits (58), Expect = 1.4 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 62 EPIDIYNVNAATHLEILVLRSQYSYNDYPTLQTETRYCIRL 184 EP+D+ VN + L S + +++PTL T + YC+ L Sbjct: 768 EPVDLIMVN--DEVARLYQNSTRAVDEFPTLPTISCYCVAL 806 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 311 DFHGEGITSCNKNQNPQNYICVI 243 DF EGI S +K +P ++IC + Sbjct: 1173 DFSNEGIFSNHKALHPDDHICEV 1195 >SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1029 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 406 SVSSKVLNSSE*RNQNTEIHTYVFNTYIHTQYIFKHFIK 522 SV+S++ S+ + + + + N Y H Q + KHF K Sbjct: 347 SVNSRIQVVSDVDDDEDDENAFSQNYYSHLQMVAKHFSK 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,148,441 Number of Sequences: 5004 Number of extensions: 44215 Number of successful extensions: 119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -