BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1204 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18G6.14c |rps7||40S ribosomal protein S7|Schizosaccharomyces... 77 2e-15 SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 27 3.1 SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomy... 26 5.5 SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 25 7.2 >SPAC18G6.14c |rps7||40S ribosomal protein S7|Schizosaccharomyces pombe|chr 1|||Manual Length = 195 Score = 77.4 bits (182), Expect = 2e-15 Identities = 39/82 (47%), Positives = 57/82 (69%), Gaps = 2/82 (2%) Frame = +3 Query: 15 KIIKASGAEADSFETSISQALVELETNS-DLKAQLRELYITKAKEIELHN-KKSIIIYVP 188 KI+K S ++ + ++Q L +LE++S D+ +LR L IT A+E+E+ KK+I+++VP Sbjct: 6 KIVKRSSSQPTETDLLVAQCLYDLESSSKDMAKELRPLQITSAREVEVGGGKKAIVVFVP 65 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 P LKAF K Q RL RELEKKF Sbjct: 66 QPLLKAFHKCQARLTRELEKKF 87 Score = 60.5 bits (140), Expect = 2e-10 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 385 K+ +HV+F+ R+ILPKP K+RV QKRPRSRTLT+V++AILE Sbjct: 85 KKFADRHVIFIAQRRILPKPGRKSRVT--QKRPRSRTLTAVHNAILE 129 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +3 Query: 279 ETVRSCLSPATKPVLLTNKRGHAQ 350 E+ + ++ +TKPV +T+K GH++ Sbjct: 1069 ESTKPAVNNSTKPVAVTSKNGHSR 1092 >SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1010 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 570 FAQPEWLNWQICKALNILL 626 F++ EW+++ C+ALNI L Sbjct: 75 FSKDEWMHFITCQALNITL 93 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 25.4 bits (53), Expect = 7.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 492 SPCSTSPFASWRNSEEAPHPIALSQQFAQPEWL 590 SP + +SE+ H + L++Q+A+P+W+ Sbjct: 209 SPLEVHTIFTHISSEDLAH-LGLNEQYARPDWM 240 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,602,954 Number of Sequences: 5004 Number of extensions: 52705 Number of successful extensions: 152 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -