BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1204 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) simila... 83 2e-16 At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) simila... 83 2e-16 At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ri... 78 4e-15 At1g48830.2 68414.m05465 40S ribosomal protein S7 (RPS7A) simila... 73 1e-13 At1g48830.1 68414.m05464 40S ribosomal protein S7 (RPS7A) simila... 73 1e-13 At3g05040.1 68416.m00547 expressed protein weak similarity to ex... 29 3.6 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 29 3.6 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 29 3.6 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 28 4.7 At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating]... 28 4.7 At1g65670.1 68414.m07452 cytochrome P450 family protein similar ... 28 6.2 >At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 82.6 bits (195), Expect = 2e-16 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 2/82 (2%) Frame = +3 Query: 15 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 188 KI K G FE ++QAL +LE TN +LK++L++LYI +A ++++ N+K+++IYVP Sbjct: 7 KIHKDKGVAPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVQMDISGNRKAVVIYVP 66 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 KAF+KI +RLVRELEKKF Sbjct: 67 FRLRKAFRKIHLRLVRELEKKF 88 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 385 K+ GK V+FV R+I+ P + V +RPR+RTLTSV++A+LE Sbjct: 86 KKFSGKDVIFVATRRIMRPPKKGSAV----QRPRNRTLTSVHEAMLE 128 >At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 82.6 bits (195), Expect = 2e-16 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 2/82 (2%) Frame = +3 Query: 15 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 188 KI K G FE ++QAL +LE TN +LK++L++LYI +A ++++ N+K+++IYVP Sbjct: 7 KIHKDKGVAPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVQMDISGNRKAVVIYVP 66 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 KAF+KI +RLVRELEKKF Sbjct: 67 FRLRKAFRKIHLRLVRELEKKF 88 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 385 K+ GK V+FV R+I+ P + V +RPR+RTLTSV++A+LE Sbjct: 86 KKFSGKDVIFVATRRIMRPPKKGSAV----QRPRNRTLTSVHEAMLE 128 >At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ribosomal protein S7 homolog - Brassica oleracea, EMBL:AF144752 Length = 190 Score = 78.2 bits (184), Expect = 4e-15 Identities = 41/82 (50%), Positives = 58/82 (70%), Gaps = 2/82 (2%) Frame = +3 Query: 15 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 188 KI K AE E ++QAL +LE TN +LK++L++LYI +A +++ N+K+++IYVP Sbjct: 7 KIKKDKNAEPTECEEQVAQALFDLENTNQELKSELKDLYINQAVHMDISGNRKAVVIYVP 66 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 KAF+KI RLVRELEKKF Sbjct: 67 FRLRKAFRKIHPRLVRELEKKF 88 Score = 41.1 bits (92), Expect = 6e-04 Identities = 22/47 (46%), Positives = 31/47 (65%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 385 K+ GK V+FV R+I+ P V +RPR+RTLTSV++A+LE Sbjct: 86 KKFSGKDVIFVTTRRIMRPPKKGAAV----QRPRNRTLTSVHEAMLE 128 >At1g48830.2 68414.m05465 40S ribosomal protein S7 (RPS7A) similar to 40S ribosomal protein S7 homolog GI:5532505 from [Brassica oleracea] Length = 191 Score = 73.3 bits (172), Expect = 1e-13 Identities = 35/82 (42%), Positives = 56/82 (68%), Gaps = 2/82 (2%) Frame = +3 Query: 15 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELHN-KKSIIIYVP 188 KI K G E + ++QA +LE TN +LK++L++LY+ A ++++ +K+I++ VP Sbjct: 7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVP 66 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 KA++KI +RLVRELEKKF Sbjct: 67 YRLRKAYRKIHVRLVRELEKKF 88 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 385 K+ GK V+ + R+I+ +P K A KRPR+RTLTSV++AIL+ Sbjct: 86 KKFSGKDVILIATRRIV-RPPKKGSAA---KRPRNRTLTSVHEAILD 128 >At1g48830.1 68414.m05464 40S ribosomal protein S7 (RPS7A) similar to 40S ribosomal protein S7 homolog GI:5532505 from [Brassica oleracea] Length = 191 Score = 73.3 bits (172), Expect = 1e-13 Identities = 35/82 (42%), Positives = 56/82 (68%), Gaps = 2/82 (2%) Frame = +3 Query: 15 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELHN-KKSIIIYVP 188 KI K G E + ++QA +LE TN +LK++L++LY+ A ++++ +K+I++ VP Sbjct: 7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVP 66 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 KA++KI +RLVRELEKKF Sbjct: 67 YRLRKAYRKIHVRLVRELEKKF 88 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 385 K+ GK V+ + R+I+ +P K A KRPR+RTLTSV++AIL+ Sbjct: 86 KKFSGKDVILIATRRIV-RPPKKGSAA---KRPRNRTLTSVHEAILD 128 >At3g05040.1 68416.m00547 expressed protein weak similarity to exportin 5 [Homo sapiens] GI:10444427 Length = 522 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 558 LSQQFAQPEWLNWQICKALNILLKI 632 LSQQ+ QPEW N + + +LL++ Sbjct: 179 LSQQWIQPEWQNNYLSDPMGLLLRV 203 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 334 KEATLKDIDLCVRCYPRGGARYPIRPIVSRITIHW 438 +E++LK CVRCYP G Y + + R+++ + Sbjct: 180 RESSLKYQTRCVRCYP-NGTGYALSSVEGRVSMEF 213 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 28.7 bits (61), Expect = 3.6 Identities = 25/94 (26%), Positives = 52/94 (55%), Gaps = 1/94 (1%) Frame = +3 Query: 54 ETSISQALVELETN-SDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRL 230 E + SQ + L++ +D+K QLR+ TK+KEI + +S++ + K+Q+R Sbjct: 915 EEAKSQEIEALQSVLTDIKLQLRDTQETKSKEIS--DLQSVLTDI---------KLQLRD 963 Query: 231 VRELEKKFVVNM*SLLETVRSCLSPATKPVLLTN 332 +E + K + ++ S L+ ++ + +K + +TN Sbjct: 964 TQETKSKEISDLQSALQDMQLEIEELSKGLEMTN 997 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 334 KEATLKDIDLCVRCYPRGGARYPIRPIVSRITIHW 438 +E++LK CVRCYP G Y + + R+ + + Sbjct: 181 RESSLKYQTRCVRCYP-NGTGYALSSVEGRVAMEF 214 >At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating], putative / glycine decarboxylase, putative / glycine cleavage system P-protein, putative strong similarity to SP|P26969 Glycine dehydrogenase [decarboxylating], mitochondrial precursor (EC 1.4.4.2) {Pisum sativum}; contains Pfam profile PF02347: Glycine cleavage system P-protein Length = 1044 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +1 Query: 349 KDIDLCVRCYPRGGARYPIRPIVSRITIHWPSFYN 453 KD+ LC P G + + + WPSF N Sbjct: 570 KDLSLCHSMIPLGSCTMKLNATTEMMPVTWPSFTN 604 >At1g65670.1 68414.m07452 cytochrome P450 family protein similar to Cytochrome P450 90A1 (SP:Q42569) [Arabidopsis thaliana] Length = 482 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 349 KDIDLCVRCYPRGGARYPI 405 K++ LC RC+P G R+P+ Sbjct: 195 KELALCWRCFPSGWFRFPL 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,976,133 Number of Sequences: 28952 Number of extensions: 292131 Number of successful extensions: 871 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 869 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -