BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1203 (557 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosa... 27 2.5 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 25 5.7 SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 25 10.0 SPBC215.05 |gpd1||glycerol-3-phosphate dehydrogenase Gpd1|Schizo... 25 10.0 >SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 941 Score = 26.6 bits (56), Expect = 2.5 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -2 Query: 400 NDVSVNEQLRFRSNCSFYYLLAIKIVVVIN-SNKQHKNRQHVRLGYLNNYEL 248 N V +N +L L K++ ++ SN H+ QH+ +G N+Y+L Sbjct: 394 NIVEINNRLDLVEKFKLLPELCSKVINLLKKSNDTHRILQHLLMGRGNSYDL 445 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 25.4 bits (53), Expect = 5.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 112 EELKKYIRIHLIILMKCAYLC 50 E+ + YIRI L+ LM+C +C Sbjct: 1331 EDKENYIRILLLPLMECMAIC 1351 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 24.6 bits (51), Expect = 10.0 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 328 IVVVINSNKQHKNRQHVRLGYLNNYE 251 ++ + N++ + V LGYLNN+E Sbjct: 492 LLAAAHRNREKCKKLSVELGYLNNHE 517 >SPBC215.05 |gpd1||glycerol-3-phosphate dehydrogenase Gpd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 385 Score = 24.6 bits (51), Expect = 10.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 Query: 249 YHYTLHMSSSVYETSI*FKGEKNKINKI 166 +H+ + V+E I +KGEK K+ ++ Sbjct: 50 HHFRSKVRMWVFEEEIEYKGEKRKLTEV 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,095,130 Number of Sequences: 5004 Number of extensions: 39191 Number of successful extensions: 64 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -