BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1203 (557 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL353631-1|CAI16126.1| 522|Homo sapiens netrin G2 protein. 31 3.6 AL159997-3|CAI40855.1| 522|Homo sapiens netrin G2 protein. 31 3.6 >AL353631-1|CAI16126.1| 522|Homo sapiens netrin G2 protein. Length = 522 Score = 30.7 bits (66), Expect = 3.6 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -2 Query: 430 AFSYLLPLPRNDVSVNEQLRFRSN-CSFYYLLAIKIVVVINSNKQHKNRQHVRLGYLNN 257 A SYL PLP + + SN CS+ L + V N + ++ QH RLGY N Sbjct: 330 AGSYL-PLPHGSPNAYCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRN 387 >AL159997-3|CAI40855.1| 522|Homo sapiens netrin G2 protein. Length = 522 Score = 30.7 bits (66), Expect = 3.6 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -2 Query: 430 AFSYLLPLPRNDVSVNEQLRFRSN-CSFYYLLAIKIVVVINSNKQHKNRQHVRLGYLNN 257 A SYL PLP + + SN CS+ L + V N + ++ QH RLGY N Sbjct: 330 AGSYL-PLPHGSPNAYCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRN 387 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,093,399 Number of Sequences: 237096 Number of extensions: 1177519 Number of successful extensions: 1426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5590411794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -