BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1201 (316 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0522 + 3779404-3779439,3779594-3779709,3780120-3780327,378... 25 9.4 >02_01_0522 + 3779404-3779439,3779594-3779709,3780120-3780327, 3781446-3781611,3781713-3781842,3782496-3782619, 3782794-3782844,3783140-3783262,3783504-3783602, 3783680-3783790,3783868-3783957,3784035-3784175, 3787913-3788116,3788154-3788290,3788429-3788662, 3789535-3789829,3789963-3790017,3790144-3790245, 3790581-3790669,3790807-3790899 Length = 867 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 134 RSFYLICILQYLTTYIKYCIYLQEHKRNFEPP 229 RS L C++Q L +K L+ K F PP Sbjct: 541 RSVVLFCVIQNLINCLKIGCLLKPFKGRFIPP 572 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,028,164 Number of Sequences: 37544 Number of extensions: 106256 Number of successful extensions: 138 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 386885760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -