BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1196 (538 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 6.9 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 9.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.1 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 124 YL*KHALIVLFIFFTALA*QTPHVQALFH*FRSFKEIQHAT 2 YL + ++F+FF AL V LFH F + I +T Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHRFGTIAHILAST 1360 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 124 YL*KHALIVLFIFFTALA*QTPHVQALFH*FRSFKEIQHAT 2 YL + ++F+FF AL V LFH F + I +T Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHRFGTIAHILAST 1360 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 124 YL*KHALIVLFIFFTALA*QTPHVQALFH*FRSFKEIQHAT 2 YL + ++F+FF AL V LFH F + I +T Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHRFGTIAHILAST 1360 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.7 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 124 YL*KHALIVLFIFFTALA*QTPHVQALFH*FRSFKEIQHAT 2 YL + ++F+FF AL V LFH F + I +T Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHRFGTIAHILAST 1360 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -3 Query: 128 IIFVKTRTYCSLYIFYSTSLTDTACTGVISL 36 IIF +C +IF++ L C +L Sbjct: 174 IIFTMHLLFCCAFIFFNMHLLFLLCLDYFTL 204 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 9.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 343 NGTGPLSTEEEDERLKQPSGRHRRRCPRNG 432 NG S++E+ R QPS + R NG Sbjct: 352 NGFPKRSSDEQQWRNNQPSTSNNRWHNNNG 381 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/42 (21%), Positives = 16/42 (38%) Frame = -1 Query: 415 GVDVGRTAASSARLPPRWTGARCRSGSSLSPSQPFRQLESID 290 G + + + PP + G RC + S P ++D Sbjct: 273 GTCLDKVGGFECKCPPGFVGPRCEGDINECLSNPCSNAGTLD 314 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,983 Number of Sequences: 336 Number of extensions: 2764 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -