BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1196 (538 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 29 0.33 SPAC3A12.02 |||inorganic pyrophosphatase|Schizosaccharomyces pom... 26 3.1 SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 25 7.2 SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|... 25 7.2 SPAC683.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 25 7.2 SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pomb... 25 7.2 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 25 9.5 >SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 534 Score = 29.5 bits (63), Expect = 0.33 Identities = 23/61 (37%), Positives = 26/61 (42%) Frame = -1 Query: 397 TAASSARLPPRWTGARCRSGSSLSPSQPFRQLESIDLSSKTWVSNPVAESFRSHARSSRW 218 ++ SSA LP + S SSLS S P LSS T S P S S SS Sbjct: 142 SSVSSAILPSSTSVEVSISSSSLSSSDPLTSSTFSSLSSSTSSSQPSVSSTSSSTFSSAA 201 Query: 217 P 215 P Sbjct: 202 P 202 >SPAC3A12.02 |||inorganic pyrophosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 286 Score = 26.2 bits (55), Expect = 3.1 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -1 Query: 439 PAFHFADIGVDVGRTAASSARLPPRWTGARCRSGSSLSPSQPFRQ 305 P F D+ + + + PRWT A+C S SP P +Q Sbjct: 34 PISFFHDVPLTSDKDTFNMVTEIPRWTQAKCEI-SLTSPFHPIKQ 77 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 25.0 bits (52), Expect = 7.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 332 RRSRTAPGPCPPRRKTSA*SSRP 400 R S TA P P RRKT ++RP Sbjct: 368 RTSPTAAPPPPSRRKTGGLNTRP 390 >SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 25.0 bits (52), Expect = 7.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 197 DDHYTQNSHTNLNGDRNRH 141 DDH +Q+ HT+ N + H Sbjct: 524 DDHVSQHEHTHENSQEHHH 542 >SPAC683.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 105 Score = 25.0 bits (52), Expect = 7.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 415 RCPRNGTPEARRSSHVLEAVPRRIGT 492 RC RNG E R +H +PR + + Sbjct: 73 RCLRNGRTEVRLYTHYKRHLPRSVNS 98 >SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 814 Score = 25.0 bits (52), Expect = 7.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 349 TGPLSTEEEDERLKQPSGRHRRRCPRNGTPEARRSS 456 T + EE+ + +PS +H+R NG+ +S+ Sbjct: 95 TAVVKEEEDFNEIAKPSPKHKRVSKANGSKNGAKSA 130 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 24.6 bits (51), Expect = 9.5 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 275 GLA*QINRLELSEWLRRTQRRSRTAPGPCP-PRRKTSA*SSRPAD 406 G+ + +++ SE + +T P P P P+ K+SA S+PA+ Sbjct: 346 GITSGLRKVDKSEMTHKNPNLRKTGPTPGPKPKIKSSA-PSKPAE 389 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,207,935 Number of Sequences: 5004 Number of extensions: 44928 Number of successful extensions: 138 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -