BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1196 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 24 3.7 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 23 4.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.5 CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal pe... 23 8.6 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 23.8 bits (49), Expect = 3.7 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +1 Query: 334 TIPNGTGPLSTEEEDERLKQPSGRHRRRCPRNGTPEARRSSHVLEAVPRR 483 T P G G T+ D++ + P R+GT E S P+R Sbjct: 200 TPPKGAGATGTQHSDQQQEPPRPSSPPAIRRSGTLEVTFSERTF-VTPKR 248 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 23.4 bits (48), Expect = 4.9 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +1 Query: 334 TIPNGTGPLSTEEEDERLKQPSGRHRRRCPRNGTPEARRSSHVLEAVPRR 483 T P G G T+ D++ + P R+GT E S P+R Sbjct: 200 TPPKGAGATGTQHSDQQQELPRPSSPPAIRRSGTLEVTFSERTF-VTPKR 248 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 6.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -3 Query: 143 H*ARNIIFVKTRTYCSLYIFYSTSLTDTACTGVIS 39 H NII + Y S Y L TAC G S Sbjct: 3102 HNTSNIIGITEDHYSSCYPIEYNGLLTTACAGTNS 3136 >CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal peptidase protein. Length = 247 Score = 22.6 bits (46), Expect = 8.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 383 RSSSSSVDRGPVPFGIV 333 ++SS S + GPVP G+V Sbjct: 213 QNSSDSRNYGPVPIGLV 229 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,081 Number of Sequences: 2352 Number of extensions: 13030 Number of successful extensions: 48 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -