BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1192 (633 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 28 0.21 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 28 0.21 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 25 1.5 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 25 1.5 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 24 3.5 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 24 3.5 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 4.6 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 6.1 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 6.1 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 23 8.1 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 23 8.1 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = -3 Query: 622 GKWSPGKHG*AQFFVGPSSGRCKLCHQLQCKRTSPFSPACLFCIGIREVA 473 G W KHG F + C SP C C+G+ E A Sbjct: 965 GDWQSRKHGDMTFHLAQVLSGHGFFRDYLCHNGFTSSPDCQLCVGVPETA 1014 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 28.3 bits (60), Expect = 0.21 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 179 EPAYPVETSKYVERSTQADPADKHLSQNNYAPPQNSYYPQNTYAPPQNT 325 EPA+ T +Y + DPAD L +N P + P +T ++T Sbjct: 150 EPAFHPLTDEYSNAAVCIDPADGRLKRNLLCPVRLETQPLHTLPDIEST 198 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 386 LGRELL*SKSDMKACSRWDDRCFEEVHR 303 L RE K D+ RW DR +E +H+ Sbjct: 295 LNREADQIKQDVADLERWIDRIYEAIHQ 322 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 386 LGRELL*SKSDMKACSRWDDRCFEEVHR 303 L RE K D+ RW DR +E +H+ Sbjct: 295 LNREADQIKQDVADLERWIDRIYEAIHQ 322 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 356 DMKACSRWDDRCFEEV 309 D K CSR + RC+E++ Sbjct: 392 DTKICSRANARCYEQI 407 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 356 DMKACSRWDDRCFEEV 309 D K CSR + RC+E++ Sbjct: 392 DTKICSRANARCYEQI 407 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.8 bits (49), Expect = 4.6 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -3 Query: 454 SIGDLILVFVTAIITIIHFILDHW 383 ++ DL+L VT +T++ + +W Sbjct: 84 AVSDLLLCLVTMPLTLVEILTKYW 107 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 6.1 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 265 LRPPSKLILSSEYLCT 312 L+PPS++ILS+ +L T Sbjct: 326 LKPPSQIILSTIFLVT 341 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 6.1 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 265 LRPPSKLILSSEYLCT 312 L+PPS++ILS+ +L T Sbjct: 326 LKPPSQIILSTIFLVT 341 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 532 YTGADGKVYTVHYWARQRTGL 594 Y G G+V +V W R+ +G+ Sbjct: 257 YPGVYGRVASVRDWVRENSGV 277 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 532 YTGADGKVYTVHYWARQRTGL 594 Y G G+V +V W R+ +G+ Sbjct: 257 YPGVYGRVASVRDWVRENSGV 277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,594 Number of Sequences: 2352 Number of extensions: 15111 Number of successful extensions: 27 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -